KEGG   Danio rerio (zebrafish): 449927Help
Entry
449927            CDS       T01004                                 

Gene name
usp4, im:7139722, unpEL, wu:fa11d11
Definition
ubiquitin specific protease 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     449927 (usp4)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   449927 (usp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
6
AA seq 1009 aa AA seqDB search
MAEGGGPESGNASDPDEKPVITQTPVPSTESQKQSIGTLLKTLLRKGDEWYLIDSRWFKQ
WKKYVGFDSWDLYNVGEHNLYPGPIDNSGLFSDRKSQSLKEHLIDELDYVLVPTEAWNKL
VSWYGSLGNQKPIIRKVVEHGMFVKHCKVEVYLLELNLCENDNMDKVVTRHFSKADTIDT
IEKEMRSLFDIPSEKETRLWNKYMSNTYEQLNKLDSTVQDAGLFQGQVLVIEKKNEDGTW
PRQSCHSKSSTSTSRNYTTSPKPSSNSSATISSTITNGDSNSNSGYMLNNSTSGNRLGSY
NSYSSSYSYRESAAQPGLCGLSNLGNTCFMNSALQCLSNTPPLTEYFLEDRYEAEINREN
PLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFLLD
GLHEDLNRVKKKPYLALRDAEGRPDEIVAKEAWANHRLRNDSIIVDIFHGLFKSTLVCPE
CSKVSVTFDPFCYLTLPLPMKKDRTMEVYLVRTDPQFRAMQFRVVVPKMGAVADLCSALA
KLSGVPSENMVVADVYNHRFHKIYKRDDGLNQIMEKDDIFVYEVLEEDSERMNLPVYFRE
RHAKHSGGSSGTMLFGQPLLITVPRLNLTVDTLYERVLERIGRYVKRSQGTITESRASAS
ATSSSSSQSPECLASVSSHGTGLSGCSSPVSDGASCSAGSNGSNHSGTCNGPNGVCDGDE
EAMDHQESPEPENSHSDTVDGEEDSEPENGPNSSGGKSFNSRPKLFSFSMVNSYGTANIS
SLPFDGNLLKLTTHSTVAIDWDSDTKRLCYDDQEAEAYDKHESMLHAQKKKTTVALRECI
ELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRCWRDKLDTVV
DFPIRDLNMSEFVCDPKADPYIYDLIAVSNHYGGMGGGHYTAYGKNKADGKWYYFDDSSV
SAATEDQIVTKAAYVLFYQRRDADTPSKSPPSASLGGAPETPDDHMDTN
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atggcggagggaggcggacccgagtcgggtaacgcttcggaccctgacgagaagccggtg
atcacacagacaccagtaccgtccaccgagagtcaaaagcagagcatcgggacactgcta
aaaacgctacttcgaaagggagacgagtggtatttgattgacagccggtggttcaaacag
tggaagaaatatgttggctttgacagctgggatttgtacaatgttggagagcacaatctc
tacccgggacccattgacaactctggcctcttttcagatcgcaagtcccagtcgctgaaa
gaacatcttatagatgagttagactatgttttagtgcctactgaggcctggaataagctg
gtcagttggtatggctctctgggaaatcagaaacccatcatcagaaaggttgttgaacat
gggatgtttgttaaacactgtaaggttgaagtgtatttgcttgagttgaatctgtgtgaa
aatgacaacatggacaaagttgtcactcgccatttcagcaaagcagacactatagatact
attgaaaaggaaatgaggtctttatttgacatcccatctgaaaaggaaactcgtctttgg
aataaatatatgagtaacacctatgaacagcttaacaagcttgacagcaccgtacaggat
gcagggctttttcagggccaggtgcttgttatagagaagaagaatgaggatggcacatgg
cccagacagagctgccattcaaagtccagcacttcaacttctcggaattatacaacctcc
ccaaagccttcttcaaactcatctgccaccatatcttccacaattaccaatggagatagc
aatagcaactctggttacatgctgaacaacagtacttctggtaacagattgggaagttac
aactcgtacagctcgtcctacagttacagagaatctgctgctcagccgggcctctgcggc
ctgagcaacttgggcaacacctgctttatgaactctgccctccagtgcctgagcaacacc
ccccctctgacggaatatttcttggaggatcgatatgaagctgagatcaaccgggaaaat
ccattagggatgagaggagagattgcggaggcctatgcggatctggtcaaacagatgtgg
cttagtcggagcagttatgtggctccacgcacttttaaaacccaggtgggtcggtttgcc
ccgcagttctcagggtaccagcaacaagactctcaggagctgctagcctttttgttagac
ggcttacatgaagaccttaaccgtgtcaagaagaagccttacctggccctgagagatgca
gagggacgacctgatgagattgtagccaaggaagcatgggcgaatcaccggttgcggaat
gattccataatcgtagacattttccatggcttgtttaaatctaccctggtctgtcccgaa
tgctccaaagtttccgttacctttgacccattctgctacctcacactgccccttcccatg
aaaaaggatcgcactatggaggtgtaccttgtccgcactgacccgcagttcagagccatg
caatttcgtgttgtggttcccaaaatgggtgctgtggcagacctgtgcagcgctttggcc
aagctatctggagttccttcagaaaacatggttgtggcggatgtttacaatcacagattt
cacaaaatctacaaacgggatgatggtctcaatcaaattatggagaaagatgacatattt
gtttatgaggtgttagaagaagacagtgagaggatgaatctgccagtgtactttagagag
aggcatgctaaacacagtggaggctcttcgggcacaatgctcttcggtcaacctcttctc
atcaccgtcccgcgcctcaacctcaccgtggataccctctacgagcgcgtgctggagaga
attgggcgatacgttaaacgttcacaaggtaccattacagagagtagagcatctgcttca
gccacatcttctagcagcagccaatcaccagaatgcctcgcttcagtgtccagtcacggc
acaggcctgagtggctgcagcagcccagtttcagatggagcttcctgcagcgctggatcc
aacggcagcaaccattctggaacctgcaacggccctaatggagtttgtgatggagatgag
gaagctatggaccaccaggagagtccagagccagaaaacagccattcggacactgtggac
ggagaggaggattctgaaccagagaatgggccaaatagtagcggaggaaaatcttttaat
tctcggccaaaactcttttctttcagcatggtcaactcctacggcacagccaacatcagt
tctcttccatttgatggcaatctactgaagctaacaactcactcaacagtagccattgat
tgggactcggacacaaaaagattgtgctatgatgatcaggaagctgaggcctatgacaaa
cacgagagtatgcttcatgctcaaaagaagaagactacagtagctttacgggaatgcatt
gagctctttactacaatggagactttaggagagcatgatccatggtactgccccacgtgt
aagaaacaccagcaggccactaagaagtttgatctgtggtctcttccacgcattttggtt
gtgcatctgaagcgcttctcctacaaccgctgctggagagacaagctcgacactgttgtg
gactttccaattagggacttaaacatgtcagagtttgtgtgtgaccccaaagctgaccca
tacatctacgacctcattgctgtttccaaccattatggaggaatgggcggaggccactac
acggcttacggcaagaacaaggcggatggcaaatggtattactttgacgacagcagtgtg
tctgctgctactgaggatcagattgtgactaaagcagcctacgtgctcttttaccaacgc
agagatgcagacacgccgtccaaatcccccccgtccgcttcactaggaggagctccggag
actcccgacgaccacatggacaccaactga

DBGET integrated database retrieval system