KEGG   Danio rerio (zebrafish): 450083Help
Entry
450083            CDS       T01004                                 

Gene name
gla, zgc:101584
Definition
(RefSeq) galactosidase, alpha (EC:3.2.1.22)
  KO
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    450083 (gla)
  Lipid metabolism
   00561 Glycerolipid metabolism
    450083 (gla)
   00600 Sphingolipid metabolism
    450083 (gla)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    450083 (gla)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    450083 (gla)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     450083 (gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
14
AA seq 409 aa AA seqDB search
MRASIIVVIGLVCLLVPAAALDNGLALTPTMGWLHWERFMCNTDCDADPQNCIREELFMQ
MADVMVKEGWKDAGYEFVCIDDCWPSQQRDAQGRLQADPKRFPSGIKKLADYVHSKGLKL
GIYADVGTKTCAGYPGSLGYYDIDAKTFADWGVDLLKFDGCFMPDWHQLGEGYINMSSAL
NQTGRSIVYSCEWPLYEWQHQQPDYEAIRKTCNHWRNYGDVYDQWTSVKSILDWTAEKQK
IVVPVAGPGGWNDPDMLIIGNFGLSRDQQQTQMALWAIMAAPLLMSNDLRDICPKAKELL
QNKQIIAINQDPLGKQGYRILKADSFELWERPLSGNRLAVAVMNRQEIGGPRRFTISVAI
MPSWKLCNPKCNVTQIMPTYKEMGVQNLLSEVVVQVNPTGTTLLTVNPL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcctcaattatagtcgttatcggacttgtatgtttattagtcccagccgcggcg
ctagacaacggcctggctttaactcccaccatgggctggctgcactgggagagattcatg
tgcaacacagactgtgatgcggatcctcaaaactgcattagagaggagctcttcatgcag
atggcagatgtgatggtgaaggagggatggaaggatgctggatatgagtttgtgtgcatt
gatgattgctggccttcgcaacaaagggacgcacaggggcgcctgcaggcagaccccaaa
aggtttcccagtggcatcaaaaaactggcagattatgtccattctaaaggactgaagctg
ggaatatatgcagatgtgggcacaaaaacttgcgcaggttaccctgggagtttgggctat
tatgacatcgatgcaaaaacctttgcggactggggtgtggatctgttaaaatttgacggg
tgtttcatgcctgactggcatcagctgggagaaggttatataaatatgtcaagtgcacta
aaccagactggcagaagtattgtttactcttgtgaatggccgttatatgagtggcagcac
caacagcctgactatgaggcaattcgcaagacctgtaaccactggcgtaattatggagat
gtgtatgaccagtggaccagtgtgaagagcatcctggactggacagcagaaaagcagaag
atcgtcgtcccagtggcaggaccaggaggatggaatgaccctgacatgctgatcattgga
aacttcggcttgagtcgcgatcagcagcagactcagatggcattgtgggcaatcatggcg
gctccacttctaatgtctaacgacctgcgagacatctgtcccaaagccaaagaactactg
cagaacaagcagatcatcgccatcaaccaggaccctctgggcaaacagggctatcggata
ttgaaggctgacagttttgagctgtgggaaaggcccttgtcaggcaacaggctggccgtg
gcagtgatgaacagacaggagattggaggtccgcgcagatttactatttcagtggcaata
atgcctagctggaagctttgtaacccgaaatgcaacgtaacccagatcatgcccacttac
aaggaaatgggcgtccaaaatctcttgtcagaggtggtggtccaagtcaaccctacaggc
acaacactactcaccgtcaacccactgtga

DBGET integrated database retrieval system