KEGG   Danio rerio (zebrafish): 474325Help
Entry
474325            CDS       T01004                                 

Gene name
dck, wu:fc15f06, zgc:101771
Definition
deoxycytidine kinase (EC:2.7.1.74)
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    474325 (dck)
   00240 Pyrimidine metabolism
    474325 (dck)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     474325 (dck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 263 aa AA seqDB search
MSPTAKRACPSPLNDSLEKRLKRISIEGNIAAGKSTFVRLLEEHDREWEVVPEPIARWCN
VQTQHDDHEELTTSQKSGGNVLQMMYEKPERWAYTFQSYACMSRIRSQIKSTNGKLREAE
NPVQFFERSVYSDRYIFASNLYESECVNETEWAIYQDWHSWLHKQFGKHIELDGIIYLRA
KPERCLERLHLRGREEEQGIPLEYLEKLHYKHECWLQHRTMSMDFDYLNDVPVLTLDVND
DFKDNNMMCADMIEKVKEFLSTL
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctccaacagccaagagagcctgtcccagtcctctgaatgacagcctggagaaaaga
ctcaagcgcatctccattgaaggcaacatcgcggcgggtaaatccacttttgttcgcctg
ctggaggagcatgatagagaatgggaggttgtaccagaacccatcgctagatggtgcaat
gtacaaactcaacacgacgaccatgaggagctgaccacgtctcagaagagcggaggaaac
gtgctgcagatgatgtacgagaagccggagcgctgggcctacaccttccagagctacgcc
tgcatgagccgcatccgctcgcagatcaaatccaccaacggcaagctgagagaggccgaa
aatccggtgcagttcttcgagagatccgtctacagcgacaggtacatcttcgcctctaac
ctgtacgagagcgagtgtgtgaacgagactgagtgggccatctatcaggactggcacagc
tggctgcataagcagttcgggaagcacattgagctggatggcatcatttacctgagggcg
aagccagagaggtgtttggagcgactgcatctaagaggaagagaggaggagcagggcatt
cctttggagtatctggagaaactgcattataaacatgagtgctggttacagcacagaacc
atgagtatggactttgattatctgaatgatgtgcccgttctcaccctggatgtcaatgat
gattttaaagacaacaacatgatgtgcgctgatatgattgagaaggtaaaggagtttctg
agcaccctgtga

DBGET integrated database retrieval system