KEGG   Danio rerio (zebrafish): 494031Help
Entry
494031            CDS       T01004                                 

Gene name
usp2a, zgc:92134
Definition
(RefSeq) ubiquitin specific peptidase 2a
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     494031 (usp2a)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   494031 (usp2a)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    494031 (usp2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 394 aa AA seqDB search
MPSMRHSYTVTIPEEPPATALSLLKQDMRRKNSVSGSMLVSTFVGLLINHAKNSKSAQGL
VGLRNLGNTCFMNSILQCLSNTQSLRDYCLHNSHRRDLNNNNRTHTALMEEFAKLIQTMW
TSSSSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRGNTED
FDHLPDEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCSECGYCSTVFDPFWDLSLPIA
KGYGEVSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTVQKFPKILVLHLKRFSE
ARIRTSKLSTFVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPEN
GEWYTYNDSRVTPMSASQVRSSDAYVLFYERAGL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcatgcgacattcatatacagtgacaataccagaggagccacctgcgactgcg
ctctctcttctcaaacaagacatgaggaggaaaaactctgtgtccggctccatgctggtc
tccacattcgtcgggcttcttattaatcatgccaagaactcaaagagtgcccagggcctg
gtcgggcttcgtaatctgggaaatacatgttttatgaactccatcctccagtgtcttagc
aacacacagagcctgcgagactactgtcttcacaactcccaccgccgagacctcaacaac
aacaaccgcacacacactgctctcatggaagagtttgccaagcttatccagacaatgtgg
acttcctcaagcagtgaagctgtcagtccctctgagttcaaaacacagattcagagatac
gcccccagatttgtgggctacaatcaacaggatgctcaggagtttctacggttcctgctt
gacggcttgcacaatgaagtaaacagggtcacggtccggccacggggaaacacagaagat
tttgaccacttgcctgatgaagaaaaagggaaaaagatgtggtctaagtatttagagaga
gaagacagcaaaattgtagatctgtttgtaggccagctaaagagctctctgacctgcagc
gaatgcggttattgttccactgtgttcgatcccttctgggatctttccttacctatcgcc
aagggctatggagaggtgagcctaatggactgcatgcggctctttacaaaagaagacgtg
cttgatggggacgagaagcctacatgttacagatgcaaagccagacggcgatgtacgaag
aaatttacggttcagaagtttcctaaaattttagttcttcatctgaaacgcttctcagaa
gcccgcattcgaaccagcaaactgtctacttttgtcaacttcccaatgaaagacctggac
ctcagggaatttgcctctgacagaagcagtagtgctgtgtataatctgtatgcagtgtcc
aatcactcaggcacgactatgggaggccactacacagcatactgctgcaatcctgaaaat
ggggaatggtacacgtataatgactccagagtcacgccaatgtctgccagccaagttcgc
agtagcgacgcctatgtgctgttctacgagcgagctggactctga

DBGET integrated database retrieval system