KEGG   Danio rerio (zebrafish): 494031Help
Entry
494031            CDS       T01004                                 

Gene name
usp2a, zgc:92134
Definition
ubiquitin specific peptidase 2a (EC:3.4.19.12)
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 391 aa AA seqDB search
MRHSYTVTIPEEPPATALSLLKQDMRRKNSVSGSMLVSTFVGLLINHAKNSKSAQGLVGL
RNLGNTCFMNSILQCLSNTQSLRDYCLHNSHRRDLNNNNRTHTALMEEFAKLIQTMWTSS
SSEAVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTVRPRGNTEDFDH
LPDEEKGKKMWSKYLEREDSKIVDLFVGQLKSSLTCSECGYCSTVFDPFWDLSLPIAKGY
GEVSLMDCMRLFTKEDVLDGDEKPTCYRCKARRRCTKKFTVQKFPKILVLHLKRFSEARI
RTSKLSTFVNFPMKDLDLREFASDRSSSAVYNLYAVSNHSGTTMGGHYTAYCCNPENGEW
YTYNDSRVTPMSASQVRSSDAYVLFYERAGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattcatatacagtgacaataccagaggagccacctgcgactgcgctctctctt
ctcaaacaagacatgaggaggaaaaactctgtgtccggctccatgctggtctccacattc
gtcgggcttcttattaatcatgccaagaactcaaagagtgcccagggcctggtcgggctt
cgtaatctgggaaatacatgttttatgaactccatcctccagtgtcttagcaacacacag
agcctgcgagactactgtcttcacaactcccaccgccgagacctcaacaacaacaaccgc
acacacactgctctcatggaagagtttgccaagcttatccagacaatgtggacttcctca
agcagtgaagctgtcagtccctctgagttcaaaacacagattcagagatacgcccccaga
tttgtgggctacaatcaacaggatgctcaggagtttctacggttcctgcttgacggcttg
cacaatgaagtaaacagggtcacggtccggccacggggaaacacagaagattttgaccac
ttgcctgatgaagaaaaagggaaaaagatgtggtctaagtatttagagagagaagacagc
aaaattgtagatctgttcgtaggccagctaaagagctctctgacctgcagcgaatgcggt
tattgttccactgtgttcgatcccttctgggatctttccttacctatcgccaagggctat
ggagaggtgagcctaatggactgcatgcggctctttacaaaagaagacgtgcttgatggg
gacgagaagcctacatgttacagatgcaaagccagacggcgatgtacgaagaaatttacg
gttcagaagtttcctaaaattttagttcttcatctgaaacgcttctcagaagcccgcatt
cgaaccagcaaactgtctacttttgtcaacttcccaatgaaagacctggacctcagggaa
tttgcctctgacagaagcagtagtgctgtgtataatctgtatgcagtgtccaatcactca
ggcacgactatgggaggccactacacagcatactgctgcaatcctgaaaatggggaatgg
tacacgtataatgactccagagtcacgccaatgtctgccagccaagttcgcagtagcgac
gcctatgtgctgttctacgagcgagctggactctga

DBGET integrated database retrieval system