KEGG   Danio rerio (zebrafish): 497647Help
Entry
497647            CDS       T01004                                 

Gene name
kcnj11l, zKir6.2, zgc:123029
Definition
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 11, like
  KO
K05004  
potassium inwardly-rectifying channel subfamily J member 11
Organism
dre  Danio rerio (zebrafish)
Brite
Ion channels [BR:dre04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   497647 (kcnj11l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 432 aa AA seqDB search
MLARKGLLPDGFLLTRLAEDAQPSRIRPKSQRARFITKSGSCNVAHKNIREQGRFLQDVF
TTMVDLKWQHSLLIFTSAFLCSWMLFAMVWWLLAFAHGDLEPRDPNEPGPVPCVTSIHSF
TSAFLFSIEVQVTIGFGGRMVTEECPLAIIVLIIQNILGLIINAIMLGCVFMKTAQANRR
AETLIFSRNAVIAPRNGRPTLMFRVGDLRKSMIISANIQLQVIRRTVTAEGEVIPVCQLD
IQVENPLRSNGIFLVSPLIISHTIDRGSPLYELSAQSMATEDLEIIVILEGVVETTGITM
QARTSYIPEEILWGRRFVSIMTEEDGRYSVDYSKFGNTVPVRMPALSAKELDQTRGVQDS
GPHEGKPQGWGLVRAGRGGYRRGGARACDDTAAKPWYVPAEKEEEKKGQKKTVKLEEIGR
EIEEETTEDMSD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgttggcccgcaaaggtcttttgcctgatgggttcttgttaacgcgactcgctgaagat
gcacaacccagccgcatccggccaaagtcacaaagggcacgttttatcaccaagagcggc
tcatgtaatgtagcccacaagaatattcgagaacagggtcggtttctccaagatgtgttc
accaccatggtggacctgaaatggcagcattctttgctcatcttcacctcagcgttcctc
tgctcctggatgctctttgccatggtgtggtggctcctggcattcgctcatggagatcta
gaacctcgagatcccaatgaacccggacctgtgccgtgcgtcacatccattcactccttc
acttctgcttttctgttctccattgaagtgcaggtaactattggtttcggaggacgaatg
gtgacagaggagtgtccgctggccatcatagtcctcatcatccagaacattctgggcctg
atcatcaacgccatcatgcttggctgtgtgttcatgaagacagctcaagccaaccgcaga
gcagaaaccctcatcttctcccgcaacgcagtcattgccccaaggaatggcagaccgaca
ttgatgtttcgtgttggagatctgagaaaaagcatgatcatctctgccaacatacagctg
caggttattcggcggacagtgacagcggagggcgaagtgattcccgtctgtcagttagat
atccaggtggaaaaccctctcaggagcaacggcatattcctcgtctctccactcattatc
agtcacaccattgacagagggagtccactgtacgagctctcagcgcagtcaatggctacc
gaagatctggagatcattgtcattttagaaggtgttgtggagacgactggcatcacaatg
caggcccgcacatcctacataccagaagagatcttgtggggtcggcgtttcgtctctatt
atgacagaggaggatggacgctactctgtcgactactccaaatttggaaacactgttcct
gtacggatgccagcgctcagtgctaaggagctggaccaaaccaggggcgtgcaggacagc
ggaccccatgagggtaaacctcagggctgggggctggtgagggcgggacgaggtgggtac
aggaggggtggagcaagggcatgtgatgacacggcagcaaagccatggtacgtgccagcg
gagaaagaggaggagaagaagggtcaaaagaaaaccgtgaagcttgaggagataggaaga
gagattgaagaagagacaactgaggatatgagcgattag

DBGET integrated database retrieval system