KEGG   Danio rerio (zebrafish): 503600Help
Entry
503600            CDS       T01004                                 

Gene name
cltcb, im:7145213, wu:fd07f11, zgc:113234
Definition
clathrin, heavy polypeptide b (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
dre  Danio rerio (zebrafish)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    503600 (cltcb)
   04142 Lysosome
    503600 (cltcb)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   503600 (cltcb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
15
AA seq 1677 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMSDPNT
PIRRPISADSAIMNPASKVIALKAAKTLQIFNIEMKSKMKAHTMTEDVSFWKWISLNTIA
LVTDNAVYHWSMEGDSQPIKVFDRHSSLAGCQIINYRTDAKQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAGFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QAFPKKAVDVFFPPEAQNDFPVAMQISSKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATSGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNNLFAGGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKFESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRNVMRISPEQGLQFSQMLVQDE
EPLADITQIVDVFMEYNLIQQCTSFLLDALKNNRPTEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHVAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSMECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLTELFESFKSFEGLFYFLGSIVN
FSQDPEVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDQELIHVCNENSLFKSLSRYLVRRKDPELWASVL
LEVNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGLVKEAIDSYIKADDPSAYMEV
GQAAAQSGNWEDLVKFLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYEAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWGELVFLYDKYEEYDNAIITMMN
HPADAWKESQFKDIITKVANVELYYRAVQFYLEFKPLLLNDLLIVLSPRLDHTRAVNFFS
KVKQLPLVKPYLRSVQNHNNKSVNEALNNLFITEEDFQALRTSIDAYDNFDNISLAQSLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDKLYKDAMQYASESKDTELAEELLQWFLED
DKKECFAACLFTCYDLLRPDVVLETAWRHNLMDFSMPYFIQVMREYLSKVDKLDASESLR
KEEEQLTEAQPIVYGTPQLMLTAGPNVAVPPQQPYGYGYPTATGYTQPAQPGFGYGM
NT seq 5034 nt NT seq  +upstreamnt  +downstreamnt
atggctcagatcctgcctatccgcttccaggagcacctgcagctccagaacctgggcata
aacccagcgaacattgggtttagcaccctcaccatggagtcagacaagttcatctgtatc
cgggagaaggtgggcgagcaggcccaggtggtgatcattgacatgagtgatcccaataca
cccatccgcaggcccatctctgcagatagcgccatcatgaacccggccagcaaagtcatt
gcacttaaagcggcaaaaacccttcagattttcaacatcgaaatgaagagcaagatgaag
gcccacaccatgaccgaggacgtttcattttggaagtggatctcgctcaataccatagca
cttgttacagacaacgcggtctatcactggagtatggaaggagactcgcaacccatcaaa
gtctttgaccgacattccagtttagcgggctgtcaaattattaactaccgcactgacgcc
aaacagaaatggctgcttctgatcggaatttcagcacagcaaaaccgtgttgtgggcgca
atgcaactttactcggtggacagaaaggtgtcacagccgatcgaaggccatgctgctgga
tttgctcagtttaaaatggagggaaatgctgaggaatccacacttttctgctttgctgtt
cgggggcaagcaggaggaaagttgcacattattgaggttggaacacctccaacagggaat
caagcttttccaaagaaagcagtcgatgtgtttttccctccagaggcccagaatgatttc
ccagttgccatgcagataagctctaaacacgatgttgtgtttctcatcaccaaatatggc
tacatccacctgtatgaccttgagacgggcacctgcatctacatgaacaggatcagcgga
gagaccatatttgtcacagcccctcacgaagccacatctggaatcattggcgtgaaccgc
aagggacaggttctgtctgtgtgcgtggaggaagaaaacatcatcccttatatcactaat
gtactgcagaacccagatctggccctcaggatggctgtccgcaacaacctggcaggtgca
gaggagctctttgctcgcaaattcaacaacctctttgctggtggaaactactctgaagct
gccaaagtggctgccaatgcaccaaagggcatcctgcgcaccccagacaccatccgtcgg
ttccagagtgttcctgcacagcccggtcagacttcacccctgctgcagtacttcgggatt
ctgctggatcagggccagctgaacaagtttgagtcattggaactttgcaggcccgtcctg
cagcagggccgcaagcagctcctggagaaatggctgaaagaagataagttggagtgttct
gaagagttgggggatctggtgaagtctgtggatccgactcttgctcttagtgtttatctg
agagccaacgttccaaacaaagtcatccagtgttttgcagaaaccgggcagttccagaaa
attgtactgtatgcaaagaaggttggctacactccagactggatcttcctgttgaggaac
gtcatgcggatcagtccagaacaaggcctgcagttctcccaaatgctcgttcaagatgag
gaacctctggctgacattactcagatcgtggacgtgtttatggagtataatctgatccag
cagtgcacttctttcctactggatgccctgaagaacaaccggcccaccgagggtcctttg
cagactcgtctgttggagatgaacctgatgcatgctccacaggtggcagatgccatcctg
ggcaatcagatgttcactcactatgatcgggctcatgtggcacagctgtgtgaaaaggct
ggtcttcttcagagggctctggagcactatactgacctttatgacatcaaacgagcggtg
gtccacacacacctgctcaacccagagtggctggtgaatttctttggctctctctcggtt
gaagactctatggagtgtttgagagccatgctgtctgccaacatacggcagaacctgcag
atctgtgtccaggtggcctccaagtatcacgagcagctctccacacagtccctcacagag
ctcttcgagtccttcaagagctttgagggtctgttttacttcctgggctccattgtgaac
tttagccaggatccagaggttcactttaaatacattcaggctgcctgtaagactggtcaa
atcaaagaggtggagagaatctgcagggagagcaactgttatgatcctgagcgagtgaag
aacttcctcaaggaagcaaaactgactgaccagctgcccctcatcattgtgtgtgaccgc
tttgattttgtccatgaccttgtgctctacttgtaccgcaacaacctccagaagtacatt
gagatttatgttcagaaggtcaaccccagccgtttgcctgtggtgattggagggctactg
gatgtggattgctctgaggacgtcattaagaacctcattctggtggtcagaggacagttc
tccactgatgagcttgtggcggaggtggagaaaagaaacagactgaagctgcttctgcca
tggctggaggcccgtatccacgagggctgtgaggaacctgccacccataatgccctggct
aagatctacattgacagcaacaacaacccagagcgcttcctccgtgagaacccctactac
gatagccgcgttgtgggcaagtactgcgagaagagggacccccatctggcctgtgtggct
tatgaaaggggacagtgtgaccaagagctcatccatgtttgcaatgagaactcactcttc
aagagtctgtcccgataccttgtgcgtcgtaaagaccccgagctgtgggctagtgtgctt
ctggaagtcaacccttacaggagaccccttatcgaccaggttgtgcagactgctctttct
gagactcaggatcctgaggaagtttctgttactgtcaaagctttcatgactgctgacctg
cctaatgaactcatcgagctactggagaagattgtcctggacaactccgtttttagtgaa
cacaggaatctgcagaacctcctcatcctgacagccatcaaagctgaccgcactcgtgtc
atggagtacatcaaccgcctcgacaactacgatgcccctgacatcgctaacatcgccatt
agcaatgagctcttcgaggaggcttttgccatcttcaggaagtttgatgtaaacacatct
gcagtgcaggttctcatcgagcacattgggaatctggaccgggcttatgagtttgccgag
cgctgcaatgagccagctgtgtggagtcagttggctaaagcacaactgcagaaggggctg
gtgaaagaggctattgactcttacatcaaagctgatgacccttcagcctacatggaagtg
ggacaagctgcagcccaaagcggaaactgggaggatttggtcaagtttttgcagatggct
cgtaagaaggcccgtgaatcatatgtggagactgagctgatctttgccctggccaagact
aaccgtctagctgaactggaggagtttatcaacgggccaaacaacgcacacattcaacaa
gttggtgaccgatgctatgatgagaagatgtacgaggcagctaaactactttataacaat
gtatccaactttggtcgtctggcctccactctagtgcatcttggggaatatcaggcagct
gtcgatggggcccgtaaagccaacagcacacggacctggaaagaggtttgctttgcctgt
gttgatgggaaggagtttcgcctggctcagatgtgtggattacatattgtcgttcatgct
gatgaacttgaggagctcatcaactattaccaggaccgtggctatttcgaggagctgatc
accatgctggaggcggctctgggcttggagcgcgctcatatgggcatgttcacagaactg
gccatcctctactccaaatttaagccacagaagatgagggagcacctggagctcttctgg
tccagagtcaacattcccaaggttttaagggcagcagaacaggctcatctgtggggggag
ctagtcttcctgtatgataaatatgaggagtacgacaacgccatcatcaccatgatgaac
catcctgcagatgcctggaaagagagccagtttaaagacatcataactaaggtggctaat
gttgagctgtattacagagccgtccagttctacctggagttcaaaccgctgttactgaat
gacctgctgatcgtattgtctcctcgtcttgaccacactcgtgctgtcaacttcttcagc
aaggtcaagcaattgccattggtgaaaccatacctgagatcagtacagaaccacaacaac
aagtctgtaaatgaggcactaaataatctcttcatcacagaggaggattttcaggctctg
cgcacatccatcgatgcctacgacaacttcgacaacatatctctggctcagagcctggag
aagcacgagctcatcgagttcaggcgaatcgctgcatacctgttcaaaggcaacaaccgc
tggaagcagagtgtggagctctgcaagaaagacaaactttacaaggatgctatgcagtac
gcttcagagtcgaaggacacagagctggcagaggagctgctgcagtggttcttggaagat
gacaagaaagagtgttttgccgcctgcctgttcacctgctacgacttgctgaggcctgac
gtggtgctggagacggcgtggaggcacaacctcatggacttttccatgccctacttcatt
caggtcatgagggagtacctctccaaggttgataagttggatgcttctgagtctttgagg
aaagaggaagagcagctcacggaggcacaacccattgtctatggcacaccccagctgatg
ctcactgcaggtcccaatgtggcagttcccccacagcagccttacggctatggctacccc
acagcgaccggctacacccaacccgcacagcccggcttcggctatggcatgtaa

DBGET integrated database retrieval system