KEGG   Danio rerio (zebrafish): 503607Help
Entry
503607            CDS       T01004                                 

Gene name
clk4b, zgc:112975
Definition
CDC-like kinase 4b
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 259 aa AA seqDB search
MLDWFDHHGHICIVFELLGLSTYDFLKENGFMPFSLTQIRHMADQIFRAVRFLHKNKLTH
TDLKPENILFVDSNYDIKYNSRMKRDERTLKRLDVKVVDFGNATYDHEHHTSVVSTRHYR
APVVILELGWNQACDVWSLGCILVEFYLGLTLFQTHDSKEHLAMMEKVLGPIPTHLLQKT
KKRRYVHHDKLDWDEHSSAGRYVRKHCKPLKQYMSSKTPEHELLFDLLQKMMEYDSSKRI
TLEQAIGHPFFNPLRKARK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgactggttcgatcaccacggccacatctgcatagtgtttgagctgctgggtctg
agcacatatgacttcctgaaggagaatggattcatgcctttctcgctgacccagattaga
cacatggcggaccagatctttagggctgtgcgctttctgcataaaaataagttgacgcac
actgacctgaagcctgaaaacattctctttgtggactccaactatgacattaaatataac
tcaaggatgaagcgagatgagaggaccttaaagaggttggatgtgaaagtggtggacttt
ggcaatgccacgtatgaccatgaacatcacacctctgttgtttcaacccgtcattacaga
gctcctgtagtcatacttgaactgggctggaaccaggcctgtgacgtctggagtttgggt
tgtatcctggttgagttctatctgggcttaacgttatttcagactcatgatagtaaggaa
catctggccatgatggagaaggttttaggccccattccaacacacctactccagaaaaca
aagaagcggcgctatgtacatcatgacaaactggattgggacgagcacagctcagctggg
agatatgtgaggaaacactgtaaacctctaaagcaatacatgtcttctaaaacgccggag
cacgagctgctttttgacctgctgcagaagatgatggagtatgattcatccaaacgaatt
accctggagcaggctatcgggcatcctttttttaacccgttaagaaaagcgagaaagtga

DBGET integrated database retrieval system