KEGG   Danio rerio (zebrafish): 503607Help
Entry
503607            CDS       T01004                                 

Gene name
clk4b
Definition
(RefSeq) CDC-like kinase 4b isoform 2
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     503607 (clk4b)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  CLK family
   503607 (clk4b)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    503607 (clk4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pox_ser-thr_kin Spo7_2_N
Motif
Other DBs
NCBI-GeneID: 503607
NCBI-ProteinID: NP_001013312
ZFIN: ZDB-GENE-050227-19
Ensembl: ENSDARG00000005908
Vega: OTTDARG00000022644
Position
21
AA seq 259 aa AA seqDB search
MLDWFDHHGHICIVFELLGLSTYDFLKENGFMPFSLTQIRHMADQIFRAVRFLHKNKLTH
TDLKPENILFVDSNYDIKYNSRMKRDERTLKRLDVKVVDFGNATYDHEHHTSVVSTRHYR
APEVILELGWNQACDVWSLGCILVEFYLGLTLFQTHDSKEHLAMMEKVLGPIPTHLLQKT
KKRRYVHHDKLDWDEHSSAGRYVRKHCKPLKQYMSSKTPEHELLFDLLQKMMEYDSSKRI
TLEQAIGHPFFNPLRKARK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgactggttcgatcaccacggccacatctgcatagtgtttgagctgctgggtctg
agcacatatgacttcctgaaggagaatggattcatgcctttctcgctgacccagattaga
cacatggcggaccagatctttagggctgtgcgctttctgcataaaaataagttgacgcac
actgacctgaagcctgaaaacattctctttgtggactccaactatgacattaaatataac
tcaaggatgaagcgagatgagaggaccttaaagaggttggatgtgaaagtggtggacttt
ggcaatgccacgtatgaccatgaacatcacacctctgttgtttcaacccgtcattacaga
gctcctgaagtcatacttgaactgggctggaaccaggcctgtgacgtctggagtttgggt
tgtatcctggttgagttctatctgggcttaacgttatttcagactcatgatagtaaggag
catctggccatgatggagaaggttttaggccccattccaacacacctactccagaaaaca
aagaagcggcgctatgtacatcatgacaaactggattgggacgagcacagctcagctggg
agatatgtgaggaaacactgtaaacctctaaagcaatacatgtcttctaaaacgccggag
cacgagctgctttttgacctgctgcagaagatgatggagtacgattcatccaaacgaatt
accctggagcaggccatcgggcatcctttttttaacccgttaagaaaagcgagaaagtga

DBGET integrated database retrieval system