KEGG   Danio rerio (zebrafish): 503607Help
Entry
503607            CDS       T01004                                 

Gene name
clk4b, zgc:112975
Definition
CDC-like kinase 4b
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     503607 (clk4b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   503607 (clk4b)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    503607 (clk4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 259 aa AA seqDB search
MLDWFDHHGHICIVFELLGLSTYDFLKENGFMPFSLTQIRHMADQIFRAVRFLHKNKLTH
TDLKPENILFVDSNYDIKYNSRMKRDERTLKRLDVKVVDFGNATYDHEHHTSVVSTRHYR
APVVILELGWNQACDVWSLGCILVEFYLGLTLFQTHDSKEHLAMMEKVLGPIPTHLLQKT
KKRRYVHHDKLDWDEHSSAGRYVRKHCKPLKQYMSSKTPEHELLFDLLQKMMEYDSSKRI
TLEQAIGHPFFNPLRKARK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcttgactggttcgatcaccacggccacatctgcatagtgtttgagctgctgggtctg
agcacatatgacttcctgaaggagaatggattcatgcctttctcgctgacccagattaga
cacatggcggaccagatctttagggctgtgcgctttctgcataaaaataagttgacgcac
actgacctgaagcctgaaaacattctctttgtggactccaactatgacattaaatataac
tcaaggatgaagcgagatgagaggaccttaaagaggttggatgtgaaagtggtggacttt
ggcaatgccacgtatgaccatgaacatcacacctctgttgtttcaacccgtcattacaga
gctcctgtagtcatacttgaactgggctggaaccaggcctgtgacgtctggagtttgggt
tgtatcctggttgagttctatctgggcttaacgttatttcagactcatgatagtaaggaa
catctggccatgatggagaaggttttaggccccattccaacacacctactccagaaaaca
aagaagcggcgctatgtacatcatgacaaactggattgggacgagcacagctcagctggg
agatatgtgaggaaacactgtaaacctctaaagcaatacatgtcttctaaaacgccggag
cacgagctgctttttgacctgctgcagaagatgatggagtatgattcatccaaacgaatt
accctggagcaggctatcgggcatcctttttttaacccgttaagaaaagcgagaaagtga

DBGET integrated database retrieval system