KEGG   Danio rerio (zebrafish): 503731Help
Entry
503731            CDS       T01004                                 

Gene name
htatip, im:6908768, wu:fb55b08, zgc:110752
Definition
(RefSeq) HIV-1 tat interactive protein, homolog (human) (EC:2.3.1.48)
  KO
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     503731 (htatip)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 538 aa AA seqDB search
MAEPTVEIVEGCRLPVLRKNQENEDEWPLAEILSVKDIPGRKLYYVHYIDFNKRLDEWVT
PDRLDLKKLQFPKKEAKTPTKNGLPGSRPSSPEREVRKSLDLNVQSASAPSRGKTLPTPK
RKAESVSLATQVTAATPVPSLPSSAEASQASVYPAMRDSSFSIKAREEHEQLTSLTTNGT
TRRLIPSQPGRKRKNCVGTEEIVKVFQNNSPRSSTVYLPPGEDSQDSSDGIPSAPRMTGS
LVSDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKC
LQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKMYSQNLCLLAKCFLDHKTLYYDTDP
FLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKV
EGKTGTPEKPLSDLGLLSYRSYWSQTILEILMNLKSENGERPQMTINEISEITSVKKEDV
ISTLQYLNLINYYKGQYILTLSEDIVEGHERAMHKRHLRIDSKCLHFTPKDWSKRGKW
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccaacggtggaaattgttgaaggctgccgtcttccggtgctgcgaaaaaac
caagaaaatgaagacgagtggccattggctgaaattcttagtgtcaaagacattcctggc
agaaaactctactatgtccactatattgacttcaataagcgactggatgaatgggtgact
ccagatcggctagacttgaagaagctccaatttcccaaaaaggaggcaaagacccctaca
aagaatggcctgccggggtctcgtcccagctccccagaaagagaagtgaggaagagtcta
gatctcaacgttcagtctgcttcagctccttcaagaggcaaaaccctccccacaccgaag
agaaaagcagagtctgtctctttggctacacaagttacagcagcgactccagtgccttca
cttcccagctctgcagaggcaagtcaggcctcagtgtatcccgccatgagagactcttca
ttcagcattaaagccagagaagaacacgagcagctcacatctctcaccacaaatggcacc
acacgtcgtctaattccttctcaaccaggaagaaaaaggaaaaattgtgtagggacggaa
gagattgtaaaggtgttccagaataacagcccccgctcctccaccgtctatttgccacca
ggagaggattctcaggacagttctgatggtattccctctgctccccgcatgactggtagt
ttggtgtcggaccgcagtcacgatgacatcatcactcgaatgaagaacatagactgtatt
gagctgggcaggcacaggctaaagccgtggtacttttctccatatccacaggagcttact
acgcttcccatcctgtatctatgtgaattctgtctcaagtacctcaagagcctcaagtgt
ctccagaggcacctgactaaatgcaatcttcgacacccaccaggaaatgaaatctatcgc
aaaggaacgatatcctttttcgaaatagatggtcgcaaaaacaagatgtattcccaaaat
ttgtgtttattggccaaatgcttcctggaccacaagactctctactacgacacggatcct
ttcctcttctatgtaatgacagagtatgactctaagggtttccacatagtcggctacttc
tccaaggaaaaggaatcaacagaggactataacgtggcctgcattttgactttaccacct
taccagagaagaggctatggaaaacttctaattgagtttagttatgagctctctaaagtg
gaaggaaaaactggtactccagagaagcctttgtctgatctgggtctgctctcttaccgt
tcatactggtcacagacaatactggagatccttatgaacctcaaatcagagaatggagaa
cgaccacagatgaccatcaatgaaatcagtgagatcaccagcgtcaagaaggaagatgtt
atatcgactcttcaatacctcaatctcatcaattattataagggtcagtatattctcact
ctatcagaggacatagtggaaggccatgagcgggccatgcataagcggcacctccgaatc
gactccaagtgtttgcatttcactcctaaagactggagcaagaggggcaagtggtaa

DBGET integrated database retrieval system