KEGG   Danio rerio (zebrafish): 503936Help
Entry
503936            CDS       T01004                                 

Gene name
pnpla7b
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7 isoform X4
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    503936 (pnpla7b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     503936 (pnpla7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Peptidase_C74
Motif
Other DBs
NCBI-GeneID: 503936
NCBI-ProteinID: XP_005165284
ZFIN: ZDB-GENE-050309-66
Ensembl: ENSDARG00000040002
Vega: OTTDARG00000016177
Position
5
AA seq 968 aa AA seqDB search
MENEEQDDTCRSLVPSGHEIKARVQHFIEDQLHTTMWTGVLIGAAVAVSILSIFALFFYR
RHKAGEGQSEGPKYRFRKRDKVLFYGRKIMRKVQTLSSPPTSGPVSQKRTRKRTKVLSIA
RKILRIRREPPTLQPKEPPPSLLEADLTEFDMQNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCRHMVFVQLQQGEGLFRPGDTDDSIFVVQDGRLDLCIHENDGTDVVVKHVLPGDSVHS
LLSILDVITGYPAPYKTVSARAAIPTTVLRLPAQAFQSVFDKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAVPLVSVAGVVGEAGQGRGPRRHSQTNEDVSDKVPQRS
SDHYSDTSHMSREDCGKLNCTESPTTLFRKSRSLSTPLESTHAGSPDHNMTFDRSSKEAP
SSPIAIQKSNRKKSVTMHHSPSAVFHYSDTGGHSSHIHHSKVNAIFQAAKRDLLKIIQLQ
DPNLLEDRVTLRQVKAGSVVASEGDQDVSVQFVISGTLHVYQRLIDREEQSCLFVAHPGE
MVGHLAVLTGEPLIFSVRAQRDCCFLSISKTHFYEIMRAEPRMVLNVAHTVVRRVSSFVR
QIDFALDWMALEAGRAVYRQGDKSDSTFIVLSGRLRSVIMKDDGKKELAGEYGRGDLIGV
VEALTHLNRATTVHAVRDSELAKLPEGALNSIKRKYPQVVTRLIHLLGQKILGNMQQVNG
PLSVRSLGFHSPTSKWDAGNPAANLSTVTILPVSEEVPLTAFTLELQHALSAIGPTLLLT
SDIIRQRLGVAALDSVHEYRLSSWLGQQEDIHRIVLYQSDGSLTPWTQRCIRQADCIIIV
GLGEQEPTVGELERMLESSAVRAQKQLVLLHREDGPPPAGTVEWLNMRSWISRHLHLSCP
HRVFSRRSLPKLREMYQRVFEKPPDRHSDFSRLARILTGNAIALVLGGGGASVVWGLDNI
SMSVVFSR
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaagaacaagatgatacatgcagatctttggtgccatctggtcatgaaatc
aaggctcgtgtgcaacacttcatcgaggatcagttacacaccaccatgtggactggtgtg
ctgatcggagctgcagttgcagtttcaattctaagtatttttgccttattcttttacaga
agacacaaggctggagaaggtcaatctgaaggtcctaaatatcgtttcagaaaaagagac
aaagtgttgttttatggcaggaagataatgaggaaggtccagaccttgtcctcgcctccc
acctcgggtccagtatctcaaaagcgaaccaggaaaagaacaaaggtgctatcaatagct
cgcaaaatcctgcgtatccgaagagagccaccaaccctgcagcccaaagagcctccgcct
tcactcctggaagcagatctgactgaatttgatatgcaaaactctcatctgccctctgaa
gtcctgtacatgctgaaaaatgtgagggttctgggtcattttgagaagcctctgttcctg
gaactgtgtcggcatatggtgtttgttcagctgcagcaaggagaagggttgtttcgccca
ggtgatactgatgacagcatctttgtggtgcaggatggccgtctcgatctgtgtattcat
gagaatgatgggactgatgttgtggtgaagcatgttttacctggagacagtgttcacagt
cttctcagcatcctcgacgtcatcactggatatccagctccgtataaaactgtctctgca
agggctgctatcccaactactgttctccgtctccccgctcaggccttccagtctgttttt
gataaatacccagaaaccctagtccgagtcgttcagatcatcatggtgcgtcttcagaga
gttacctttcttgcccttcacaactatctgggcctgaccacagaacttttcaatccggaa
agtcaggctgttcctctggtgtcagtggccggtgttgtaggagaggctggtcaaggcaga
gggccgcgcagacactcgcagacaaatgaagacgtgtctgacaaagtcccacagagatct
tcagaccattacagtgacacaagtcacatgtccagagaagattgtggaaagctcaattgt
acagagagtccgacgactttattcaggaagtctcgctcactgtcaacacctttagaaagt
acacacgctggatctcccgaccacaatatgacctttgacagatcaagcaaagaagcccct
tcaagtcctattgccatacagaagtcaaaccggaagaagtctgtgacaatgcatcattct
ccttcagccgtgtttcactactcggacaccggagggcactccagccacatccaccatagt
aaagttaatgccattttccaagctgccaagagggacctgctaaagattatccaactccag
gatcccaatcttctggaagatcgggtgacactgagacaagtaaaggcgggctctgtggtt
gcaagtgagggagatcaggatgtaagcgtgcagtttgtcatctctggaacgcttcatgtg
taccagagactgattgacagagaagagcaatcatgtctgtttgtggcccaccctggagag
atggtgggccacctggctgttctcactggagagcctctcatcttttctgtgcgcgcccag
cgtgactgctgcttcctgtctatctccaaaacacacttctatgagataatgcgtgccgaa
cctcgaatggtgttgaatgtagctcacacagtggtgcggagggtctcctcatttgtcaga
cagatcgactttgctctggattggatggcactggaggctggacgagctgtctacagacaa
ggtgataagtcagacagcactttcattgttctgagtgggcgattgcgttctgtcatcatg
aaggatgatgggaagaaagagctggctggagagtatggacggggagacctcatcggtgtg
gtggaagctttgactcatctgaacagagccactacagtccacgcagtccgagactctgaa
ctggccaaactgcctgaaggagctctcaattctattaagaggaaatatccacaggttgtg
actcgtctgattcaccttcttggccagaagatcttggggaacatgcagcaagtgaatggt
ccactctcagtgcgcagtctgggttttcactccccaaccagtaagtgggacgcaggtaat
ccagctgccaatctgtcgacggtcaccattctgcctgtgtctgaggaagtgccactgact
gccttcacactggagctgcagcatgctctcagtgctattggtcccactttgcttctaacc
agtgacattatcagacagcgcctgggtgttgctgccttggacagtgttcacgagtatcgt
ttgtcaagctggctgggtcaacaagaggacatccaccgcattgttttatatcaatctgat
ggttctctgactccatggactcaacggtgcattcgacaggcagactgcatcatcatcgtg
ggtctgggagaacaagagcccactgtgggagagctggagcgtatgctggagagcagtgct
gtgagagctcagaagcagctggttctgctgcaccgtgaggacgggcctccacccgctgga
actgtagaatggcttaacatgcgcagctggatctcacgacatctgcacctgtcctgtcct
cacagggtcttctccaggaggagtctgcccaaattgagagagatgtatcagcgagtattt
gagaagcctcccgaccggcattctgacttctcacgtctggctcgaatcctgacaggcaac
gccatcgctctggtgctgggcggaggaggagccagtgttgtttgggggcttgacaacatc
agcatgtctgtggttttctctcgatga

DBGET integrated database retrieval system