KEGG   Danio rerio (zebrafish): 503936Help
Entry
503936            CDS       T01004                                 

Gene name
pnpla7b, im:7148262, pnpla7, si:dkey-16g11.3
Definition
patatin-like phospholipase domain containing 7b
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    503936 (pnpla7b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     503936 (pnpla7b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
5
AA seq 968 aa AA seqDB search
MENEEQDDTCRSLVPSGHEIKARVQHFIEDQLHTTMWTGVLIGAAVAVSILSIFALFFYR
RHKAGEGQSEGPKYRFRKRDKVLFYGRKIMRKVQTLSSPPTSGPVSQKRTRKRTKVLSIA
RKILRIRREPPTLQPKEPPPSLLEADLTEFDMQNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCRHMVFVQLQQGEGLFRPGDTDDSIFVVQDGRLDLCIHENDGTDVVVKHVLPGDSVHS
LLSILDVITGYPAPYKTVSARAAIPTTVLRLPAQAFQSVFDKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAVPLVSVAGVVGEAGQGRGPRRHSQTNEDVSDKVPQRS
SDHYSDTSHMSREDCGKLNCTESPTTLFRKSRSLSTPLESTHAGSPDHNMTFDRSSKEAP
SSPIAIQKSNRKKSVTMHHSPSAVFHYSDTGGHSSHIHHSKVNAIFQAAKRDLLKIIQLQ
DPNLLEDRVTLRQVKAGSVVASEGDQDVSVQFVISGTLHVYQRLIDREEQSCLFVAHPGE
MVGHLAVLTGEPLIFSVRAQRDCCFLSISKTHFYEIMRAEPRMVLNVAHTVVRRVSSFVR
QIDFALDWMALEAGRAVYRQGDKSDSTFIVLSGRLRSVIMKDDGKKELAGEYGRGDLIGV
VEALTHLNRATTVHAVRDSELAKLPEGALNSIKRKYPQVVTRLIHLLGQKILGNMQQVNG
PLSVRSLGFHSPTSKWDAGNPAANLSTVTILPVSEEVPLTAFTLELQHALSAIGPTLLLT
SDIIRQRLGVAALDSVHEYRLSSWLGQQEDIHRIVLYQSDGSLTPWTQRCIRQADCIIIV
GLGEQEPTVGELERMLESSAVRAQKQLVLLHREDGPPPAGTVEWLNMRSWISRHLHLSCP
HRVFSRRSLPKLREMYQRVFEKPPDRHSDFSRLARILTGNAIALVLGGGGASVVWGLDNI
SMSVVFSR
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgaagaacaagatgatacatgcagatctttggtgccatctggtcatgaaatc
aaggctcgtgtgcaacacttcatcgaggatcagttacacaccaccatgtggactggtgtg
ctgatcggagctgcagttgcagtttcaattctaagtatttttgccttattcttttacaga
agacacaaggctggagaaggtcaatctgaaggtcctaaatatcgtttcagaaaaagagac
aaagtgttgttttatggcaggaagataatgaggaaggtccagaccttgtcctcgcctccc
acctcgggtccagtatctcaaaagcgaaccaggaaaagaacaaaggtgctatcaatagct
cgcaaaatcctgcgtatccgaagagagccaccaaccctgcagcccaaagagcctccgcct
tcactcctggaagcagatctgactgaatttgatatgcaaaactctcatctgccctctgaa
gtcctgtacatgctgaaaaatgtgagggttctgggtcattttgagaagcctctgttcctg
gaactgtgtcggcatatggtgtttgttcagctgcagcaaggagaagggttgtttcgccca
ggtgatactgatgacagcatctttgtggtgcaggatggccgtctcgatctgtgtattcat
gagaatgatgggactgatgttgtggtgaagcatgttttacctggagacagtgttcacagt
cttctcagcatcctcgacgtcatcactggatatccagctccgtataaaactgtctctgca
agggctgctatcccaactactgttctccgtctccccgctcaggccttccagtctgttttt
gataaatacccagaaaccctagtccgagtcgttcagatcatcatggtgcgtcttcagaga
gttacctttcttgcccttcacaactatctgggcctgaccacagaacttttcaatccggaa
agtcaggctgttcctctggtgtcagtggccggtgttgtaggagaggctggtcaaggcaga
gggccgcgcagacactcgcagacaaatgaagacgtgtctgacaaagtcccacagagatct
tcagaccattacagtgacacaagtcacatgtccagagaagattgtggaaagctcaattgt
acagagagtccgacgactttattcaggaagtctcgctcactgtcaacacctttagaaagt
acacacgctggatctcccgaccacaatatgacctttgacagatcaagcaaagaagcccct
tcaagtcctattgccatacagaagtcaaaccggaagaagtctgtgacaatgcatcattct
ccttcagccgtgtttcactactcggacaccggagggcactccagccacatccaccatagt
aaagttaatgccattttccaagctgccaagagggacctgctaaagattatccaactccag
gatcccaatcttctggaagatcgggtgacactgagacaagtaaaggcgggctctgtggtt
gcaagtgagggagatcaggatgtaagcgtgcagtttgtcatctctggaacgcttcatgtg
taccagagactgattgacagagaagagcaatcatgtctgtttgtggcccaccctggagag
atggtgggccacctggctgttctcactggagagcctctcatcttttctgtgcgcgcccag
cgtgactgctgcttcctgtctatctccaaaacacacttctatgagataatgcgtgccgaa
cctcgaatggtgttgaatgtagctcacacagtggtgcggagggtctcctcatttgtcaga
cagatcgactttgctctggattggatggcactggaggctggacgagctgtctacagacaa
ggtgataagtcagacagcactttcattgttctgagtgggcgattgcgttctgtcatcatg
aaggatgatgggaagaaagagctggctggagagtatggacggggagacctcatcggtgtg
gtggaagctttgactcatctgaacagagccactacagtccacgcagtccgagactctgaa
ctggccaaactgcctgaaggagctctcaattctattaagaggaaatatccacaggttgtg
actcgtctgattcaccttcttggccagaagatcttggggaacatgcagcaagtgaatggt
ccactctcagtgcgcagtctgggttttcactccccaaccagtaagtgggacgcaggtaat
ccagctgccaatctgtcgacggtcaccattctgcctgtgtctgaggaagtgccactgact
gccttcacactggagctgcagcatgctctcagtgctattggtcccactttgcttctaacc
agtgacattatcagacagcgcctgggtgttgctgccttggacagtgttcacgagtatcgt
ttgtcaagctggctgggtcaacaagaggacatccaccgcattgttttatatcaatctgat
ggttctctgactccatggactcaacggtgcattcgacaggcagactgcatcatcatcgtg
ggtctgggagaacaagagcccactgtgggagagctggagcgtatgctggagagcagtgct
gtgagagctcagaagcagctggttctgctgcaccgtgaggacgggcctccacccgctgga
actgtagaatggcttaacatgcgcagctggatctcacgacatctgcacctgtcctgtcct
cacagggtcttctccaggaggagtctgcccaaattgagagagatgtatcagcgagtattt
gagaagcctcccgaccggcattctgacttctcacgtctggctcgaatcctgacaggcaac
gccatcgctctggtgctgggcggaggaggagccagtgttgtttgggggcttgacaacatc
agcatgtctgtggttttctctcgatga

DBGET integrated database retrieval system