KEGG   Danio rerio (zebrafish): 541323Help
Entry
541323            CDS       T01004                                 

Gene name
mapk7, bmk1, erk5, wu:fb73b02, zgc:113111
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    541323 (mapk7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    541323 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    541323 (mapk7)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     541323 (mapk7)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   541323 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 862 aa AA seqDB search
MASNKMDETNNSHTAGEASEGDSRRESNIEKVQQRGVTEGPAQPSNDTSTVTDDTTVADK
NLALLKAHSLDVKFEVGDEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTN
AKRTLRELKILKHFKHDNIIAIKDILQPVVPHSAFKSVYVVLDLMESDLHQIIHSRQPLT
PEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAVYSEES
RSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLGRRQMFPGKNYVHQLQLI
LSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAEPSALNLLAAMLRFDPRE
RISACQALEHPYLSKYHDPDDEPVCVPAFNFEFDRQPMGKEQIKEAILTEIQDFHKKKQG
VRKKIQFKPLHSSGSALSVSCQDVDMPSANSDGQPETIDLTTPTDKDTSFTEPAIDCRKD
KSVLSNYTAPSRSVSQTPPTSLPQSVPSLSLSQSQVQSLSQNLSRSLGKGGKPTAAEGTK
KEGAISEDTKAALKAALQKSALRQKARDEGTAALGIDLVRGASVGLSSSISSSNSCPEQR
RPITAQERQREREEKRKKRQERAMERKRKLKEKEKKEGKHGESLGGVLLSDNDKMLLQRW
VRMMDKPADKSQGIETSNAKTSDSNMAQIQPATGNNIIKTNSNGGESVLPKQPNKAQVFK
PPQLVSQMGQQPPGAAVQPCLSLTDTGQSSNSIPDIHTVTQQLSKSQVEDILPPVFSVTP
KGSGAGYGVGFDLDDLLTQSLTELQHSDLRESHNDLAPLSASLLSDWLEVHRMTPADMES
LQQELQLGSPMILSDNSTLPDT
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaataagatggatgagacaaataacagtcacacagcaggagaagcctcagaa
ggcgacagcaggagagagagcaacattgaaaaggtccagcaaagaggcgttacagaagga
ccagctcaacccagcaatgatacgtccacagttactgatgacactactgtcgcagacaag
aacttggccctgctcaaagcccactccctggatgtgaagtttgaagtcggggatgaatat
gacattattgagaccattggtacaggtgcatatggtgtggtctcatcagcacgaagacgg
gataatggccagcaggtggcaataaagaagatccccaatgcctttgaggttgtgacgaat
gccaaacgcacgctgcgagagctcaaaatactgaagcacttcaaacacgacaacatcatc
gccattaaagatattctccagcccgtggtccctcattcagcgttcaaatcagtgtacgtg
gttcttgacctcatggagagcgacctacatcagatcattcactcgcggcagcctttgact
ccagaacacacacgctactttctatatcagctgttaagaggcttgaaatacattcattca
gccaacgtcattcaccgcgacctcaagccatccaacctgctggtcaatgaaaactgcgag
ctaaagatcggggacttcggaatggcacggggattaagtgcggtctactctgaagagtcg
cggtcctttatgaccgagtacgtggccacccgctggtatcgtgctcctgagctcatgctg
tcgctccaccactacagcctggccatcgacctctggtccgtaggctgcatcttcggtgag
atgctcggtaggaggcagatgtttccggggaaaaactacgtgcatcagttgcagctgatt
ctttcagttttagggacgccacccgaaagcattgttggctcaattgggtcagatagggtg
cgctcttatgtgcggagccttccatccaaagcaccagaaccgcttgcagccctgtatcca
caagctgagcccagcgccttgaacttgttggctgcaatgctccgctttgaccctcgtgaa
agaatcagtgcatgtcaagcactggaacacccgtatctctccaagtaccacgacccagat
gacgaaccggtgtgcgtgcctgctttcaattttgagttcgaccggcagcccatgggcaaa
gagcaaatcaaagaagcgatactaacagagatccaggactttcataagaaaaagcagggc
gtgaggaagaagatccagtttaagccgctccattcttctggatcggccttgtcggtaagc
tgtcaggatgtggacatgcccagtgcgaactctgacggccagccggaaaccattgatctg
accactcccacagacaaggacacgtcttttactgagcctgcgatagactgcaggaaggat
aagagtgtgttatccaattacactgctccatctcgatccgtctctcagactccacccaca
agtcttccacagtcagtcccttcactctctctctcacagtcccaggtgcagtcgctctct
caaaatctctctcgttcgcttggaaaaggaggaaaaccgactgctgcggaaggtacgaaa
aaagagggagcaatatctgaagacacaaaagcagctctcaaagctgccttgcagaaatct
gcgctaagacagaaggcacgagatgaaggcactgcagctcttggtatagatttagtcaga
ggagcttctgttggtttatcctcatccatatcctcctccaactcctgtccagagcagagg
aggcccatcacggcccaggagagacaacgggagagggaagagaagcggaagaaaaggcag
gagcgggccatggagcgaaagaggaagctaaaagaaaaggaaaaaaaggaagggaaacat
ggagaatcgctgggtggcgttttactcagcgataatgacaagatgctgctgcagcgctgg
gtacgaatgatggacaaaccagcagacaaatcacaaggcatagaaaccagtaatgccaaa
accagcgacagtaatatggcccaaatacagccagcaacaggaaacaacattataaaaaca
aactccaatgggggggaatcagtgctgccaaaacagcccaacaaagcacaggttttcaaa
ccgccacagttggtgtctcagatgggacagcagcctccaggtgctgcagttcaaccctgc
ctgagtctcactgacacgggacagtcttcgaacagcatccctgatatccacaccgtcact
cagcagctctccaaatcacaggttgaagacattttgccgccagttttctcagtgactcct
aaaggcagtggagccggttatggtgtgggctttgacctcgatgacctcctcactcagtct
ctaactgaactccaacattctgacctcagggaaagtcacaatgacctagcccctctgtct
gcatccctgctttctgactggctggaggtgcatcgcatgacccctgcggacatggagtca
cttcagcaggagcttcaactgggatctcccatgatcctctcagacaactctacgcttcct
gatacctga

DBGET integrated database retrieval system