KEGG   Danio rerio (zebrafish): 541323Help
Entry
541323            CDS       T01004                                 

Gene name
mapk7, bmk1, erk5, wu:fb73b02, zgc:113111
Definition
mitogen-activated protein kinase 7 (EC:2.7.1.-)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    541323 (mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    541323 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    541323 (mapk7)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     541323 (mapk7)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   541323 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
12
AA seq 862 aa AA seqDB search
MASNKMDETNNSHTAGEASEGDSRRESNIEKVQQRGVTEGPAQPSNDTSTVTDDTTVADK
NLALLKAHSLDVKFEVGDEYDIIETIGTGAYGVVSSARRRDNGQQVAIKKIPNAFEVVTN
AKRTLRELKILKHFKHDNIIAIKDILQPVVPHSAFKSVYVVLDLMESDLHQIIHSRQPLT
PEHTRYFLYQLLRGLKYIHSANVIHRDLKPSNLLVNENCELKIGDFGMARGLSAVYSEES
RSFMTEYVATRWYRAPELMLSLHHYSLAIDLWSVGCIFGEMLGRRQMFPGKNYVHQLQLI
LSVLGTPPESIVGSIGSDRVRSYVRSLPSKAPEPLAALYPQAEPSALNLLAAMLRFDPRE
RISACQALEHPYLSKYHDPDDEPVCVPAFNFEFDRQPMGKEQIKEAILTEIQDFHKKKQG
VRKKIQFKPLHSSGSALSVSCQDVDMPSANSDGQPETIDLTTPTDKDTSFTEPAIDCRKD
KSVLSNYTAPSRSVSQTPPTSLPQSVPSLSLSQSQVQSLSQNLSRSLGKGGKPTAAEGTK
KEGAISEDTKAALKAALQKSALRQKARDEGTAALGIDLVRGASVGLSSSISSSNSCPEQR
RPITAQERQREREEKRKKRQERAMERKRKLKEKEKKEGKHGESLGGVLLSDNDKMLLQRW
VRMMDKPADKSQGIETSNAKTSDSNMAQIQPATGNNIIKTNSNGGESVLPKQPNKAQVFK
PPQLVSQMGQQPPGAAVQPCLSLTDTGQSSNSIPDIHTVTQQLSKSQVEDILPPVFSVTP
KGSGAGYGVGFDLDDLLTQSLTELQHSDLRESHNDLAPLSASLLSDWLEVHRMTPADMES
LQQELQLGSPMILSDNSTLPDT
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atggcatccaataagatggatgagacaaataacagtcacacagcaggagaagcctcagaa
ggcgacagcaggagagagagcaacattgaaaaggtccagcaaagaggcgttacagaagga
ccagctcaacccagcaatgatacgtccacagttactgatgacactactgtcgcagacaag
aacttggccctgctcaaagcccactccctggatgtgaagtttgaagtcggggatgaatat
gacattattgagaccattggtacaggtgcatatggtgtggtctcatcagcacgaagacgg
gataatggccagcaggtggcaataaagaagatccccaatgcctttgaggttgtgacgaat
gccaaacgcacgctgcgagagctcaaaatactgaagcacttcaaacacgacaacatcatc
gccattaaagatattctccagcccgtggtccctcattcagcgttcaaatcagtgtacgtg
gttcttgacctcatggagagcgacctacatcagatcattcactcgcggcagcctttgact
ccagaacacacacgctactttctatatcagctgttaagaggcttgaaatacattcattca
gccaacgtcattcaccgcgacctcaagccatccaacctgctggtcaatgaaaactgcgag
ctaaagatcggggacttcggaatggcacggggattaagtgcggtctactctgaagagtcg
cggtcctttatgaccgagtacgtggccacccgctggtatcgtgctcctgagctcatgctg
tcgctccaccactacagcctggccatcgacctctggtccgtaggctgcatcttcggtgag
atgctcggtaggaggcagatgtttccggggaaaaactacgtgcatcagttgcagctgatt
ctttcagttttagggacgccacccgaaagcattgttggctcaattgggtcagatagggtg
cgctcttatgtgcggagccttccatccaaagcaccagaaccgcttgcagccctgtatcca
caagctgagcccagcgccttgaacttgttggctgcaatgctccgctttgaccctcgtgaa
agaatcagtgcatgtcaagcactggaacacccgtatctctccaagtaccacgacccagat
gacgaaccggtgtgcgtgcctgctttcaattttgagttcgaccggcagcccatgggcaaa
gagcaaatcaaagaagcgatactaacagagatccaggactttcataagaaaaagcagggc
gtgaggaagaagatccagtttaagccgctccattcttctggatcggccttgtcggtaagc
tgtcaggatgtggacatgcccagtgcgaactctgacggccagccggaaaccattgatctg
accactcccacagacaaggacacgtcttttactgagcctgcgatagactgcaggaaggat
aagagtgtgttatccaattacactgctccatctcgatccgtctctcagactccacccaca
agtcttccacagtcagtcccttcactctctctctcacagtcccaggtgcagtcgctctct
caaaatctctctcgttcgcttggaaaaggaggaaaaccgactgctgcggaaggtacgaaa
aaagagggagcaatatctgaagacacaaaagcagctctcaaagctgccttgcagaaatct
gcgctaagacagaaggcacgagatgaaggcactgcagctcttggtatagatttagtcaga
ggagcttctgttggtttatcctcatccatatcctcctccaactcctgtccagagcagagg
aggcccatcacggcccaggagagacaacgggagagggaagagaagcggaagaaaaggcag
gagcgggccatggagcgaaagaggaagctaaaagaaaaggaaaaaaaggaagggaaacat
ggagaatcgctgggtggcgttttactcagcgataatgacaagatgctgctgcagcgctgg
gtacgaatgatggacaaaccagcagacaaatcacaaggcatagaaaccagtaatgccaaa
accagcgacagtaatatggcccaaatacagccagcaacaggaaacaacattataaaaaca
aactccaatgggggggaatcagtgctgccaaaacagcccaacaaagcacaggttttcaaa
ccgccacagttggtgtctcagatgggacagcagcctccaggtgctgcagttcaaccctgc
ctgagtctcactgacacgggacagtcttcgaacagcatccctgatatccacaccgtcact
cagcagctctccaaatcacaggttgaagacattttgccgccagttttctcagtgactcct
aaaggcagtggagccggttatggtgtgggctttgacctcgatgacctcctcactcagtct
ctaactgaactccaacattctgacctcagggaaagtcacaatgacctagcccctctgtct
gcatccctgctttctgactggctggaggtgcatcgcatgacccctgcggacatggagtca
cttcagcaggagcttcaactgggatctcccatgatcctctcagacaactctacgcttcct
gatacctga

DBGET integrated database retrieval system