KEGG   Danio rerio (zebrafish): 541364Help
Entry
541364            CDS       T01004                                 

Gene name
si:ch211-173k16.6
Definition
zgc:113333 (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    541364 (si:ch211-173k16.6)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     541364 (si:ch211-173k16.6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 471 aa AA seqDB search
MSSQKLIRLIIGSLVIVAMVKLFFNPRGSVKSKSEKTHQIIQGGNFWASQRIPLIKVVEN
KQDTVKTEQQPKVEQEESEKIQKKQEQLKPEVPEKTDPLKIVHLDLKGAPPKVKYLEQLF
PLLSSLGANGILLEYEDMFPYEGDLEILKSSFAYSPEDVEEIKSLAKRQNLELIPLVQVF
GHMEFVLKHEKYFKLREVETFPNSLNSLAQGSMELVQNMLTQVMKKHPEARWFHIGADEV
RGLGESEDSKRWLEANNGDMGKLYLNHVTAVAKFMTKQKQRIKLILWDDMFRKFSPDTIK
ESGLQDLASPMIWNYHANLNVKDIGKYISKYEQAGFRGVWFASAFKGASGIDQIWTPIDH
HLKNHIQWQEVIASMPQYKSVRFQGIALTGWQRYEHHTVLCELLPVAIPSLTVCLQTLKY
GAFNAKAQGEVQRMLGCEIQLEKNDWYETVYIFNDFIVVSINGSIYCKCNM
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccaaaagcttattaggttaatcatcggctccttagtgattgtggccatggtg
aaactgttcttcaaccccagaggaagtgtgaagtctaaaagtgaaaagacccaccagatc
atacaaggtggtaatttctgggctagccaacgaatcccactgataaaagtggttgaaaat
aaacaggataccgtgaaaacagaacaacagcctaaagttgagcaagaggaaagtgagaag
attcagaaaaaacaagagcaattaaagccagaagttcctgaaaaaacagatccactaaag
attgtgcatttagatctgaaaggtgccccacccaaagttaaataccttgagcagttattc
cccctactgtcatctttgggtgctaatgggatattgctggaatatgaggacatgtttccc
tatgagggagaccttgaaattctcaaatcaagttttgcatacagtccggaagatgtagag
gaaattaagtctctggctaaacgacaaaatctggaactgatacctttggtgcaggtgttt
ggacacatggagttcgtcttaaaacatgaaaagtattttaaattgagagaagtggaaacg
tttcccaatagtctaaactctctggcccaaggaagcatggaacttgttcaaaacatgcta
acgcaggttatgaagaagcacccagaagcacggtggttccacattggtgccgatgaggtg
cgtggcttgggcgaaagtgaagattcgaagcgatggttagaagccaacaacggagacatg
ggcaagctctacctcaatcatgtgactgcagttgcaaagtttatgaccaaacagaagcaa
agaatcaagctgatcttgtgggacgacatgttcaggaaatttagccctgacactataaaa
gaatcaggtttgcaagatcttgcttcacccatgatatggaactaccatgcaaacttgaac
gtgaaggacattggtaagtatatctccaagtatgagcaggctggatttcgtggcgtgtgg
tttgctagtgctttcaaaggagcatctgggatcgaccagatctggactccaattgatcac
catttaaaaaaccatatacagtggcaggaagtcatcgcatccatgccgcagtacaagtct
gtgagatttcaaggcattgcactgactggctggcagaggtatgagcatcacacagtgctg
tgcgagcttctcccggtggccattccttctctcactgtctgtctgcagacactgaaatat
ggtgcatttaatgctaaggcccagggtgaggtccagcgcatgcttggctgtgaaattcag
ctcgaaaaaaatgactggtatgaaacagtttatattttcaatgactttattgttgtcagc
atcaatggaagtatctactgtaaatgtaatatgtag

DBGET integrated database retrieval system