KEGG   Danio rerio (zebrafish): 541435Help
Entry
541435            CDS       T01004                                 

Gene name
acss1, cb395, sb:cb395, wu:fa05a10, wu:fc49f03, wu:fi28d10, zgc:113194, zgc:158738
Definition
acyl-CoA synthetase short-chain family member 1 (EC:6.2.1.13)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    541435 (acss1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    541435 (acss1)
   00620 Pyruvate metabolism
    541435 (acss1)
   00640 Propanoate metabolism
    541435 (acss1)
Enzymes [BR:dre01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     541435 (acss1)
Lipid biosynthesis proteins [BR:dre01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   541435 (acss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 693 aa AA seqDB search
MAGRVSASLLNSLTRGTILFKNKKCLRRSVVFISRCHARSLSRSSISAAQLDLSSHLSGR
NYADLYELSVKDPENFWGSIAKERLAWTKPFDQVSDCDISSGKINWFLGGQLNVSVNCLD
VHVANDPSRVALIWEKDEPGTEERITYRELLEMTCRLANTLKSHGVQRGERVAIYMPVSP
MAVAAMLACARIGAVHTVVFAGFSSEALAGRIQDAQCKFVITCNQGVRGGRVFDLKSTVD
KAVKSCPSVRHVFVAKRTNNSVPMGKLDIPLEEVMAGQSSECAPEPMESEEMLFMLYTSG
STGKPKGIVHTQAGYLLYASLTHQYVFDYTPGDVFGCVADIGWITGHSYVVYGPLCNGAT
SVLFESTPVYPNPGRYWETVQRLRINQFYGAPTAIRLLLKYEESWVKKYDRSSLKTLASV
GEPINHEAWDWFHNVVGDGRCPLVDTWWQTETGGVCIAPLPAEPGAEIRPAMAMRPFFGI
KPELLGEKGQIITGNDVNGALCISQPWPGMARTIFGDHQRFVDAYFKPYQGQYFTGDGAY
RTEDGYYQITGRMDDVINISGHRLGTAEIEDALDEHPDVPETAVIGIPHEIKGEVPFAFV
VLKESAAENQQAVVNELRHLVASKIAKYAVPDHFLVVKRLPKTRSGKIMRRILRKVAVQD
TSNLGDVSTLDDPSVVSEIIKAHKHYRSLAAKQ
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctggacgtgtgagcgccagtttgctgaattcattaaccaggggaactattctcttt
aaaaacaagaaatgcttgcgcagaagtgttgttttcatctcccggtgtcacgcgaggtct
ctgtccagaagcagcatcagcgcggctcagctggacctcagctcgcatctctctggaaga
aactacgcggatttatatgaactgtcagtcaaagatccagaaaacttctgggggtccatt
gccaaggaaaggctggcatggaccaaacctttcgaccaagtgtcggactgtgatatttcc
agcgggaaaatcaactggtttcttggaggacaactgaatgtctctgtgaattgtttggat
gtacacgtggcaaatgatccaagcagagtggccttgatttgggagaaagatgaacctggc
acagaggaaaggatcacatacagggagcttctggagatgacatgtcgccttgccaataca
ttaaagagtcacggagtgcagagaggagagcgagtggccatctacatgcctgtgtctcct
atggcagtggcagctatgttggcttgtgcccgtattggtgccgtacacactgtagtgttt
gcaggcttcagctcggaggctctggctggcagaattcaggatgcccaatgcaagtttgtc
attacgtgcaaccaaggtgtgagaggtggccgtgtcttcgatctgaagtctacagtggat
aaagctgtaaagagctgtccatctgtccgacatgtgtttgtggccaagagaactaacaac
agtgttccgatgggaaaactagacattcctttagaagaggtgatggcggggcagtcttca
gagtgtgctccagagcccatggagagtgaggagatgttgttcatgctgtacacctctggc
agtacagggaaacccaagggcatcgtacacacacaggccggttacctgctctacgcttcc
ctcacacatcagtatgtgtttgactacacacctggagatgtgtttggctgtgttgctgac
atcggttggataacgggtcacagttatgtggtttatggacccctgtgtaacggagccact
tcagttctgtttgaaagcacacctgtataccccaatccaggtcgttactgggagacagtt
cagaggttaagaataaaccagttttatggagctccaactgccatcagattactgttgaaa
tatgaagagagttgggtgaagaaatatgacaggtcatctctgaagacacttgcgtctgtt
ggagagcccattaatcacgaggcatgggactggttccataatgtggtcggggatggacga
tgccccctggtggacacatggtggcagacagaaactggtggcgtgtgtatagctccactt
ccagctgaaccgggagcagagattcggcctgccatggctatgagacccttttttggaatc
aagccagaactactaggggagaagggacagataataacaggaaatgatgtcaacggggct
ctgtgcattagccaaccatggcctggaatggcaagaaccatttttggagaccaccagaga
ttcgtggatgcatattttaaaccgtaccaaggtcagtattttacgggtgatggggcgtac
cgtactgaagacggatactaccagatcacaggacgaatggatgacgtcatcaatattagt
gggcatcgtctgggcaccgctgagattgaggatgcactggatgaacacccagatgttcct
gagaccgccgtgatcgggattccccatgagataaagggagaagttccatttgcgtttgta
gttttaaaagaatctgctgctgagaaccaacaggctgttgtgaatgagctgcgacaccta
gtggcctcaaaaatagctaaatatgccgttcctgatcatttcctggttgtgaagcgtctt
cctaaaacacgctctggaaaaatcatgaggagaatcttgcgaaaggttgcagtgcaggac
acaagcaacctaggggacgtgtccacgctggatgacccctccgtcgtttcagagatcatc
aaggcccataaacactacagaagtcttgcagctaagcagtag

DBGET integrated database retrieval system