KEGG   Danio rerio (zebrafish): 541509Help
Entry
541509            CDS       T01004                                 

Gene name
elp3, si:ch211-63o20.8, zgc:113140
Definition
elongation protein 3 homolog (S. cerevisiae) (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     541509 (elp3)
Transfer RNA biogenesis [BR:dre03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    541509 (elp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 548 aa AA seqDB search
MGKPKKKSDLSRAELMMMTIADVIKQLVEAHEEGKDINLNKVKTKTSAKYGLSAQPRLVD
IIAAVPPHYRRALVPKLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSD
FEYSTQSYTGYEPTSMRAIRARYDPYLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMALPE
EYRDYFIRNLHDALSGHTSNNVTEAVRYSERSNTKCVGITIETRPDYCLKRHLSDMLGYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVCESFHLAKDAGFKVVAHMMPDLPNVGMERDVE
QFIEFFENPAFRPDGLKLYPTLVIRGTGLYELWKTGRYKSYSPSALVDLVARILALVPPW
TRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDMGTECRDVRTREVGIQEIHHKVRPYQ
VELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRRCSPQSFRPELKGGVSIVRELHVYG
SVVPVSSRDPSKFQHQGFGMMLMEEAERIARDEHGSSKLAVISGVGTRNYYRKMGYELEG
PYMVKNLY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagccaaaaaagaagagtgacttgagtcgtgcagaactgatgatgatgacaata
gcagacgtcatcaagcagttggttgaggcccatgaagaaggaaaagatattaatctgaac
aaggtcaagacaaagacctcagctaaatacggcctctccgcacagccacggctggtggac
atcattgctgcagtaccaccacactatcgcagagcattggtaccaaagttgaaagccaaa
cccatccgcacagccagtgggattgcagtcgttgctgtgatgtgcaagcctcatcgctgt
ccacacattagtttcactggcaacatctgtgtctattgccctgggggtccagactccgat
tttgaatattccacacagtcatacacaggatacgagcccacatcaatgagagccatccgt
gcacgatacgatccctacctccagactaggcaccgagtagaacagctcaagcagctggga
cacagcgtggataaagtggagttcattgtgatgggaggcacattcatggctctgccggag
gagtacagggactatttcatccgtaacctccatgacgcgctgtcaggacacacgtctaac
aacgtcaccgaagctgtcaggtactcagagcgcagtaacaccaaatgtgtgggcatcacg
attgagaccagacccgactactgtctgaagagacacttgagtgacatgctgggctacggt
tgcaccagactggagatcggcgtacagagtgtttatgaggatgttgctcgggataccaac
agaggacacacagttcgggctgtgtgtgagtctttccaccttgctaaggatgctggattt
aaagttgttgctcacatgatgccagacttacccaatgttggcatggaaagagacgtggag
cagtttatagagttttttgagaaccctgccttcaggccagacgggctcaagctttaccct
acactggtgatacgaggcactggactgtatgagctgtggaaaacaggccgttataagagc
tactctcccagtgccttggtggacttggtagcaagaatactagcgctggttccaccatgg
actcgtgtgtatcgtgtacagagggatatcccaatgccactggtgagctctggagtggaa
catggcaatctgagagaactggcactggccagaatgaaggacatgggcactgagtgtaga
gatgtaagaaccagagaagtgggcatccaagagattcatcacaaagttcgaccatatcag
gtcgagctgatccgcagagactatgtggctaatggaggctgggagacctttctgtcttat
gaggaccccgagcaggatattttaattggtctcctgcgtctccgccgatgctctccgcag
tccttccggcctgagttgaagggtggtgtatccatagttcgggagctgcatgtctacgga
agtgtggttcctgtcagcagccgagatcccagcaagttccagcatcagggttttggaatg
atgttgatggaggaggccgagaggatagccagagatgagcacggctccagcaaattggct
gttatctcaggtgttggaacgaggaattactacagaaaaatgggttatgaactggagggg
ccatatatggtgaaaaacctttactga

DBGET integrated database retrieval system