KEGG   Danio rerio (zebrafish): 541523Help
Entry
541523            CDS       T01004                                 

Gene name
eif4e2, id:ibd1007, zgc:110542, zgc:158544
Definition
eukaryotic translation initiation factor 4E family member 2
Orthology
K03259  
translation initiation factor 4E
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dre03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
2
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQDNSSPKDGEKEKNDEEDKEANTTKRKAVVPGAGEHPLQYNYT
FWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIK
PMWEDDANKSGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIIS
IWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEDFHGLVNASGGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaaatttgacgccctgaaagatgatgacagtggagatcacgaccaggacaac
agctcaccgaaagacggggagaaggaaaaaaatgatgaagaggacaaagaagcaaacact
acaaagagaaaggcagtggtcccgggagccggtgaacaccctcttcagtataactacacc
ttctggtattctcgacgcacaccaggacgtccggccagcacacagagctatgaacagaac
attaaacagattggcagctttgcttcggtggagcagttctggcgtttttatagtcacatg
atccgaccgggtgatctgactggtcacagtgatttccacctgtttaaggaaggaatcaaa
cccatgtgggaggatgatgctaataagagtggtggtaaatggatcattcggctccggaaa
ggcctggcgtctcgctgctgggaaaatctgatcctggccatgcttggcgaacagttcatg
gtgggcgaggagatctgtggcgccgtcgtgtccgttcgcttccaggaggatattatttcc
atctggaataagacggccagcgatcaggccaccactgctcgcattagagacactttacgc
agagtcctcaacctgcctcctaatactataatggagtacaaaacacacaccgacagcatc
aaagcttgggaggatttccatggtctagtgaacgcaagtggaggacgctag

DBGET integrated database retrieval system