KEGG   Danio rerio (zebrafish): 541538Help
Entry
541538            CDS       T01004                                 

Gene name
Dck, dck2, wu:fe11h12, wu:fj05e11, zgc:109951
Definition
zgc:110540 (EC:2.7.1.74)
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
dre  Danio rerio (zebrafish)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    541538 (Dck)
   00240 Pyrimidine metabolism
    541538 (Dck)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     541538 (Dck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 264 aa AA seqDB search
MATPPKRLCSSFDADLSFEKRAMKVSIEGNIAAGKSTFVRLLERASEEWEVIPEPIGKWC
NVQTTENGYEELSTSQKSGGNLLQMLYDKPSRWSYTFQTYACLSRVRSQLQPPSAKLQQA
EKPVQFFERSVYSDRYVFASNLFESGDLNETEWAIYQDWHSWLLTQFESQIELDAMIYLR
ADPERCMQRLQFRGREEEQGIPLDYLEKLHYKHECWLYNQTTKLDFEYLKDLPILILDVN
EDFKNDRIKQEGVIDKVKEFLNSL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcctcctaagagactttgttcgagcttcgacgcagacctgagttttgaaaaa
agggcgatgaaggtctcgatagagggaaacattgcggcaggaaagtccactttcgtacgt
ttgttagagcgggcatcagaggaatgggaggtcataccagagcccatagggaaatggtgc
aatgtacagaccacagagaatggatatgaggagctcagcacatcccagaagagcggaggc
aacctgctgcagatgttatacgacaagccgagtcgctggtcctacactttccagacctac
gcctgtctgagtcgagtccgttcgcagcttcagcctccatctgccaaacttcagcaggca
gagaagccagtccagttctttgagcgctccgtctacagtgaccgatacgtgttcgcctcc
aatctctttgagtccggagatttgaatgagaccgaatgggccatttaccaagactggcat
tcatggcttctcactcagtttgagtcgcagattgaactggatgccatgatctatcttcgg
gctgatcctgagaggtgtatgcagcggcttcagtttagaggacgagaagaggagcagggg
attcctctggactatttggagaagctgcattataagcacgagtgttggctgtacaaccaa
accacaaagttggactttgagtatctaaaagaccttcccatcctgatcctggatgttaat
gaggattttaaaaatgacagaattaaacaggaaggtgtaattgataaggtcaaggagttt
ctgaacagcctttag

DBGET integrated database retrieval system