KEGG   Danio rerio (zebrafish): 541539Help
Entry
541539            CDS       T01004                                 

Gene name
alpi.1, alpi, im:7149588, si:ch211-262h13.1, wu:fa95f04, zgc:110794
Definition
alkaline phosphatase, intestinal, tandem duplicate 1 (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dre00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
22
AA seq 532 aa AA seqDB search
MCLVYGRAPGALLLLLLALVLNTSCSLDSAAEWEKDPAYWNDQARRTLQTALTLPLRVNR
AKNIILFVGDGMGVSTVSAARILRGQMEGQSGEETILAMDTFPYLALSKTYCVDKQVADS
ASTATAYHCGVKANAKTVGLSAKAVAYECNTTFGNEVFSVLHRAKAQGKSVGIVTTTRVQ
HASPAAAYAHSVSRKWYSDADVPSEARRQGCKDIATQLVTNTDIDVILGGGRMYMTPKGT
PDPEYSSSSHKGDRKDKKNLINVWLNARKGRNAQYVWNKEQFNAVDVKTTDCLMGLFEPK
DMRFEVFRNRTRDPSIVDMTEKAIQILSKNPKGFFLFVEGGRIDHGHHDGVAKLALTETI
MFDRAIQRASELTSESDTLTVVTADHSHVFTFGGKTPRGNPIFGLAPKQAEDDLPYTSIL
YANGPGYDHVNGTRGNVSVLDYYDEEYKQQAAVPLESETHGGEDVAIYAKGPMAHLFHGV
KEQNYVAHAMAYAACLEPYTNCPLDLYSSAGWKTPLSLTLISLTGVFWLVLR
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttggtttacggtcgggcccccggagcgcttcttctcctcctgttggccctcgtc
ctgaacaccagctgcagtctggactccgcggctgaatgggagaaggatcccgcatactgg
aatgatcaggccagacggacgctgcagacggccctcacgctgcctctcagagtcaaccga
gccaaaaacatcatcctcttcgttggtgatggaatgggagtgtccacggtttcagccgct
cgtatcctgcggggtcagatggaaggacagtccggggaggagacgattctggccatggac
acgtttccatatctcgccctgtcaaagacatattgtgtggacaagcaggtcgcggacagc
gctagcacagctacagcgtatcactgcggagtgaaggctaatgccaagacggtgggcttg
agtgccaaagcagtggcctacgagtgcaacacaacatttggcaatgaggttttctcagtg
ctgcaccgcgccaaagcacaaggaaagtctgttggcatcgtgaccaccaccagagtccag
cacgcgtcgccggctgctgcgtatgcgcattcagtcagccgtaaatggtacagcgatgca
gatgtgccctccgaagcccgccggcagggctgcaaagacatcgccacacagctggtgacc
aacactgacattgatgtcattcttggaggtggccggatgtacatgacacccaagggaacc
cctgacccagaatactcctcatcatctcacaaaggagatcgaaaagacaaaaaaaatctt
attaacgtttggctcaatgcccgcaagggaagaaacgcccagtacgtttggaacaaagag
cagttcaatgcagtagatgttaaaacaacagactgcctgatgggcctgtttgagcccaaa
gatatgagattcgaggtgttcaggaatcgtacacgtgatccttccatcgtggacatgact
gagaaagccattcaaatcctcagcaagaaccctaaaggcttttttctctttgtggaagga
ggcagaatagaccacggacaccacgacggggtggccaaacttgctctgacagagaccatc
atgttcgaccgggcgattcagagagcgtccgagctgaccagtgaatcagacacgctcact
gtcgtcaccgcagatcattcccatgtcttcacctttggtggaaaaactcctcgggggaac
ccaatttttggtctggcacctaaacaggctgaagatgatcttccatacactagtatcttg
tatgcgaacgggccaggatacgatcatgtgaacggaacaagaggaaatgtttccgttttg
gattattatgatgaagagtacaagcaacaagctgcggttcccttagaatccgagacacac
ggaggggaagatgtggctatctatgccaaaggcccaatggcacacctctttcatggagtc
aaagagcagaactatgtggcccatgccatggcttacgcagcgtgccttgagccgtacacc
aactgcccgctggatctgtacagctctgcaggctggaaaacccctctttcattgactctg
atctctctaaccggcgtgttttggcttgttttgagatga

DBGET integrated database retrieval system