KEGG   Danio rerio (zebrafish): 548343Help
Entry
548343            CDS       T01004                                 

Gene name
glb1, zgc:110823
Definition
galactosidase, beta 1 (EC:3.2.1.23)
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    548343 (glb1)
  Lipid metabolism
   00600 Sphingolipid metabolism
    548343 (glb1)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    548343 (glb1)
   00604 Glycosphingolipid biosynthesis - ganglio series
    548343 (glb1)
   00511 Other glycan degradation
    548343 (glb1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    548343 (glb1)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     548343 (glb1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   548343 (glb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 651 aa AA seqDB search
MAPVVGLVSVLLLIIPATTYATTPTFSVDYHRNCFLKDGEPFRYISGSIHYSRIPRVYWK
DRLLKMYMAGLNAIQTYVPWNFHEAVPGQYDFSGDRDLEQFLQLCQDIGLLVIMRPGPYI
CAEWDMGGLPAWLLKKKDIVLRSSDPDYLAAVDKWMGKLLPIIKRYLYQNGGPIITVQVE
NEYGSYFACDFNYMRHLSQLFRFYLGEEAVLFTTDGAGLGYLKCGSLQGLYATVDFGPGA
NVTAAFEAQRHVEPRGPLVNSEFYPGWLDHWGEKHSVVPTSAVVKTLNEILEIGANVNLY
MFIGGTNFGYWNGANTPYGPQPTSYDYDSPLTEAGDLTEKYFAIREVIKMYKDVPEGILP
PSTPKFAYGKVQMKKLKTVSETLDVLSFSGPVKTLYPPTFIEMNQAFGFVLYQTVLPVNC
VKPTPLSSPLNGVHDRAYISIDGIAAGILERNKALSINITGKAGSHVDVLVENMGRINYG
KGINDFKGLVFNLTLGADVLVNWTVYSLSVDEAVSKGLLSASGSSSTSSTSTPPPALSPP
TFYTGSFIIPDGIPDLPQDTYIQFPDWRKGQVWINGFNVGRYWPSRGPQITLFVPAHLLS
TSVQNNITVLELEASPCSSGSCMVEFTDTPILNGTVNSQYKRQLFNKQDLL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgttgtcggactagtctcggttctgctccttatcataccagccaccacgtac
gccacaactcccactttttctgtggattaccatcgaaactgctttcttaaagatggagag
cctttccgctacatatctggcagtatccactacagccggatccccagagtctattggaaa
gaccggctactcaagatgtacatggctggattgaacgccatccagacatatgtgccgtgg
aacttccacgaagcagttcctggtcagtacgacttcagtggagatcgagatctggagcaa
ttcctccagctctgccaagacatcggcctgctggtcatcatgagaccaggaccctacata
tgtgccgagtgggatatgggtggtttgcctgcctggctgctgaaaaaaaaggatattgtg
cttcgatcatctgatccagattaccttgcagcagtggacaagtggatggggaagctgttg
cccatcataaagcgttacctgtaccagaatggaggcccaatcattaccgtgcaggtagag
aatgagtatggcagctacttcgcctgtgattttaactacatgcgtcatctgagccagttg
ttccggttttatctcggggaagaggctgtgctgttcactactgatggggcaggtctgggt
tacttgaaatgtggatccctccagggcctctacgccactgttgacttcggcccaggtgca
aatgtaaccgctgcgtttgaagcacagaggcatgttgagccacgtgggcctttggtgaac
tctgagttttatcccggctggttggatcattggggcgaaaaacactcggttgttcccaca
tctgctgtagtcaagactctcaatgaaattctggaaattggagccaatgtcaacctgtat
atgttcatcggtggaactaactttggctattggaatggtgccaacactccttatggtcct
caacccaccagctatgactatgactctcctcttacagaggctggagatctcactgagaaa
tatttcgccataagggaagtcatcaaaatgtataaagatgtaccagaaggaattctgcct
ccatcaacacctaaatttgcatatggaaaagtgcaaatgaagaaactaaagactgtgtca
gagacgttagatgtgttgtctttctccggccctgtaaaaacactttaccctccaacattt
attgaaatgaatcaggcgtttgggttcgtgctttatcaaactgtgctaccagttaactgc
gtgaagcccacgccgctgtcgtcccctctgaatggagtccatgatcgggcatatatttcc
attgatggcattgctgctggtattttggagaggaacaaggcactcagcatcaatataaca
gggaaagctggcagccatgtggacgtcctggtggagaacatgggcagaatcaactacggc
aaaggaattaatgacttcaagggtctggtgtttaatctgacgctcggtgctgatgttctg
gttaactggactgtgtattccctgagtgtcgatgaagcagtcagcaagggtttgctttca
gcttcaggctcctcctccaccagctccaccagcacacctccgcctgctctttcacctcca
accttctacacaggcagcttcatcattcctgacggtatccctgatctccctcaggacacc
tacatccagttccccgactggaggaagggtcaagtgtggataaatggatttaacgttggc
cgctactggccgtcccgtgggccacagatcactctctttgtcccggcgcacctgctcagc
acctccgtccaaaacaacataaccgtcctggagcttgaggcgtccccttgctcctcaggt
tcctgcatggtggagttcactgatactcctattttgaacggcaccgtgaacagccaatac
aagagacaactattcaacaaacaagacctcttatga

DBGET integrated database retrieval system