KEGG   Danio rerio (zebrafish): 550338Help
Entry
550338            CDS       T01004                                 

Gene name
alad
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00860  Porphyrin and chlorophyll metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    550338 (alad)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     550338 (alad)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   550338 (alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 550338
NCBI-ProteinID: NP_001017645
ZFIN: ZDB-GENE-050417-123
Ensembl: ENSDARG00000100372
Vega: OTTDARG00000029202
UniProt: Q568L9
Position
5
AA seq 331 aa AA seqDB search
MTQPAESILHSGYFHPTLRYWQTCASELRPDNLIYPIFITDSPDAVEPIASLPGQARYGV
NKIEGLLRPLVDKGLKCVLIFGVPAKVAKDERGSGADADDTPAVLAVKKLRSTFPELVLA
CDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYARAGCHIIAPSDMMDGRIAAI
KQALIANDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRAC
DRDVKEGADMLMVKPGLPYLDIVREVKNKHPTHPLAVYNVSGEFAMLWHGAEAGAFDLRT
AVMEAMTAFRRAGADIIITYYTPQLLIWLTE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccagctgaatctattctacacagtggttacttccaccctactctccgatat
tggcagacctgtgcttcagaactcagaccagataaccttatatatcctatcttcattact
gacagtcctgatgcagttgaaccaattgcaagtctccctggtcaagcaagatacggtgtt
aataagatagaaggtttacttcgtccccttgtggataagggcctgaagtgtgtgctgatt
tttggagttcctgcaaaagttgcaaaggatgaaaggggctctggggcagacgcagatgac
actcctgcagtgctggctgtaaagaaactacggagcacgttccctgagcttgtgttggcc
tgtgacgtgtgtctctgtccgtatacctctcatggacactgtggaatcctacgtgaagat
ggcagcttggataatgccgcaagctgtttgaggttggctgaagttgctttggcatacgct
cgagcaggctgccacatcattgccccttcagatatgatggatggacgaattgcagccatt
aagcaagctctaattgccaatgatcttggcaacaaggtgtcagtgctgagctacagtgct
aaatttgcatcctgctactatggaccgttcagagatgctgctcagtctaagcctgctttt
ggagacagacgatgttatcagttacctcctggtgcccgaggactagcactgcgggcctgt
gaccgggatgtgaaagaaggtgctgacatgctgatggtgaaacctggattaccatatctt
gatattgtgcgagaagtgaagaataagcatcctacccatccactggctgtatacaatgta
tcaggtgaatttgccatgttgtggcatggagctgaagctggagcttttgacttgcgtact
gcagtgatggaagctatgactgccttccgtcgagcaggtgctgatatcatcataacctac
tacactccacaattgctcatatggttaacagagtaa

DBGET integrated database retrieval system