KEGG   Danio rerio (zebrafish): 550338Help
Entry
550338            CDS       T01004                                 

Gene name
alad, zgc:110219
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dre  Danio rerio (zebrafish)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    550338 (alad)
Enzymes [BR:dre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     550338 (alad)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   550338 (alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 331 aa AA seqDB search
MTQPAESILHSGYFHPTLRYWQTCASELRPDNLIYPIFITDSPDAVEPIASLPGQARYGV
NKIEGLLRPLVDKGLKCVLIFGVPAKVAKDERGSGADADDTPAVLAVKKLRSTFPELVLA
CDVCLCPYTSHGHCGILREDGSLDNAASCLRLAEVALAYARAGCHIIAPSDMMDGRIAAI
KQALIANDLGNKVSVLSYSAKFASCYYGPFRDAAQSKPAFGDRRCYQLPPGARGLALRAC
DRDVKEGADMLMVKPGLPYLDIVREVKNKHPTHPLAVYNVSGEFAMLWHGAEAGAFDLRT
AVMEAMTAFRRAGADIIITYYTPQLLIWLTE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgacacagccagctgaatctattctacacagtggttacttccaccctactctccgatat
tggcagacctgtgcttcagaactcagaccagataaccttatatatcctatcttcattact
gacagtcctgatgcagttgaaccaattgcaagtctccctggtcaagcaagatacggtgtt
aataagatagaaggtttacttcgtccccttgtggataagggcctgaagtgtgtgctgatt
tttggagttcctgcaaaagttgcaaaggatgaaaggggctctggggcagacgcagatgac
actcctgcagtgctggctgtaaagaaactacggagcacgttccctgagcttgtgttggcc
tgtgacgtgtgtctctgtccgtatacctctcatggacactgtggaatcctacgtgaagat
ggcagcttggataatgccgcaagctgtttgaggttggctgaagttgctttggcatacgct
cgagcaggctgccacatcattgccccttcagatatgatggatggacgaattgcagccatt
aagcaagctctaattgccaatgatcttggcaacaaggtgtcagtgctgagctacagtgct
aaatttgcatcctgctactatggaccgttcagagatgctgctcagtctaagcctgctttt
ggagacagacgatgttatcagttacctcctggtgcccgaggactagcactgcgggcctgt
gaccgggatgtgaaagaaggtgctgacatgctgatggtgaaacctggattaccatatctt
gatattgtgcgagaagtgaagaataagcatcctacccatccactggctgtatacaatgta
tcaggtgaatttgccatgttgtggcatggagctgaagctggagcttttgacttgcgtact
gcagtgatggaagctatgactgccttccgtcgagcaggtgctgatatcatcataacctac
tacactccacaattgctcatatggttaacagagtaa

DBGET integrated database retrieval system