KEGG   Danio rerio (zebrafish): 550388Help
Entry
550388            CDS       T01004                                 

Gene name
srd5a2b, zgc:112455
Definition
(RefSeq) steroid-5-alpha-reductase, alpha polypeptide 2b
  KO
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    550388 (srd5a2b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     550388 (srd5a2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 217 aa AA seqDB search
MILGGVMHFICLMKSHAAYGRYVDTSGSSMMVPARLAWFLQEIPALLVPLLLMVTTDGNH
GTGKHLMLWTFCLHYFQRSCIYSLLTKGRPYPFNIMLTGVVVCSINGFLQAHYLLHCATF
HNTWFSDACLLTGLIIFFLGMGINIHSDHILRNLRNPGEISYKIPRGGMFEYVSGANFFG
EIVEWLGYAVATWSLPTFAFAFFTICFIGPRAYHHHK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgggtggggtaatgcactttatttgtctcatgaagtctcacgctgcctatggc
cgctacgtggacacctcgggcagctccatgatggtgcccgcaaggctagcgtggttcctc
caggagattccagctttactggtgcccttgcttttgatggtgaccaccgatggaaaccac
ggcactgggaaacacctgatgctctggaccttctgcctgcactacttccaaaggagctgt
atctactctctgctgaccaaaggacgaccgtatccatttaacatcatgttaacaggggtg
gtggtttgctctattaacggcttcctgcaggcacactatctgctccactgtgctacattt
cacaacacatggttttctgatgcctgtttactgactggtctgatcatatttttcctagga
atgggaatcaatatccacagtgaccacattcttcgaaacctgagaaaccctggagaaata
tcctataaaatcccgagaggcggcatgttcgagtacgtgtctggagcaaatttcttcgga
gagatagtggagtggctgggatacgctgttgctacatggtctttaccaacgtttgctttt
gcttttttcacaatctgcttcataggccccagagcctatcatcatcacaagtaa

DBGET integrated database retrieval system