KEGG   Danio rerio (zebrafish): 550398Help
Entry
550398            CDS       T01004                                 

Gene name
srd5a2a
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    550398 (srd5a2a)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     550398 (srd5a2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 DUF2929
Motif
Other DBs
NCBI-GeneID: 550398
NCBI-ProteinID: NP_001017703
ZFIN: ZDB-GENE-050417-199
Ensembl: ENSDARG00000043587
Vega: OTTDARG00000029979
UniProt: Q566Z4
Position
1
AA seq 252 aa AA seqDB search
MLCQENTVHFGSWAFVVGGLLYLLKQLTTQTAYGRYVDTKSPGLMVPARAGWFIQELPSF
LVPVLLFFATESLPGVGKHILFWTFCLHYFQRTFVYSLLTKGRPSPLHIVVSAVVFCSIN
GFLQGHYMLHCTQYSSDWLTDTRFITGLLVFLCGMAINIHSDYILRNLRKPGEVSYKIPR
GGLFELVSGANFFGEIVEWCGYAVASWSFPAFSFALFTICSIGPRAYHHHRYYLEKFKDY
PKSRKAVIPFLL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctctgtcaggaaaacactgttcactttggcagctgggcttttgtagtcggtggattg
ctttaccttctgaaacaactgaccacgcaaacggcgtacggacgctatgtggacacaaaa
tcccctgggttgatggtcccagccagggcaggctggtttatacaggaacttccttcattc
ttagtgcccgtgctgttgttttttgcaacggaaagtttgccaggcgttggaaaacacata
ctgttctggacattttgtttgcactactttcaaaggacatttgtgtattcactgctgact
aaaggccgtccatctcctctccatattgtggtcagtgcggtggtcttctgctcgatcaat
ggctttctgcagggtcactacatgctgcactgcacacaatacagcagcgactggctcaca
gacacacgcttcatcactggtttgttggtgtttttgtgtggaatggccatcaatatccac
agtgactatattttacgaaacctgaggaaacccggagaggtcagctataaaatcccaaga
ggagggctgtttgagctggtgtccggcgccaacttcttcggggagattgttgaatggtgt
ggatacgccgtggccagctggtcatttcctgctttctccttcgccctgttcaccatctgc
tccatcgggcctcgagcctaccatcatcacaggtattacttggagaaatttaaggattac
cccaaatcaagaaaggctgtgatccctttcctgctataa

DBGET integrated database retrieval system