KEGG   Danio rerio (zebrafish): 550460Help
Entry
550460            CDS       T01004                                 

Definition
zgc:112084 (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    550460
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    550460
   00603 Glycosphingolipid biosynthesis - globo series
    550460
   00604 Glycosphingolipid biosynthesis - ganglio series
    550460
   00511 Other glycan degradation
    550460
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    550460
Enzymes [BR:dre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     550460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
25
AA seq 532 aa AA seqDB search
MARIAKSPRFCCCLLSVVFVSQFVERVCGVWPLPQEIQQSAESSGLSPQLFTFTYSQDSA
AQAGCSVLDTAFKRYFSIIFPDFTKDALHDMWLEPKAFVLSVSVKTRGCDGYPDEDSDES
YNLSVSEGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIVDFPRFAFRGLLLD
TSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYT
QSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYKGGKPSGTYGPVDPTVD
TTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWQSNPSVGKFMEKMGFGRDFTKLESFY
MESIMNITAALNKTSIVWQDVFDYHERIPQGTVLEIWKGETYQTELSKMTKAGHRVLLSA
PWYINHITYGQDWRNSYAVQPQNFSGTEEQKKLVIGGEVAMWGEYVDATNLNPRLWPRAC
AAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQAEPLFVGHCKHEFNGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatcgcaaagtctcctcgtttctgctgctgcctgctgtcagttgtgtttgtc
agtcagtttgtggagcgggtgtgtggagtttggccgttgcctcaggagatccaacagtct
gctgaaagctccgggctgagcccgcagctcttcactttcacatacagccaggactccgct
gcacaggcgggatgctccgtgctggacactgccttcaaaagatacttctccatcatattc
cccgactttactaaagatgcacttcatgacatgtggttggagccaaaagccttcgttctg
tcagtgagtgtcaaaaccagaggatgtgacggttaccctgacgaagattcagatgaaagc
tataacctgagtgtgtcagagggccaggctgtgctgagatcagtgactgtatggggcgct
ttgagaggtctggagtccttcagtcagcttgtgtaccgcgatgattatggcgcttatttt
gtcaacaagacggagatcgtagacttcccacgttttgcatttcgaggacttttgttggac
acttctaggcattatttacccctccatgctatcttgaagaccttggatgccatggcatat
agtaaatttaatgtcttccactggcacattgtggacgacccttcctttccgtatcagagc
cgaacttttcctgacctcagtaaaaagggagcttttcatccatttactcatatctacaca
cagtcagatgtgatgagagtgattgaacatgccaggatgaggggtattagagtcgtgccg
gagtttgactcacctggacacactcaatcatggggaaaaggccagccagatctcttgacc
ccctgttataaaggcggtaagccttctggaacgtacggtcctgttgatccaacagtggac
accacctataggttcatggagcgtctcctgaaggaggtgaagttcgtctttccagactcg
tatgttcatttaggaggggatgaggtcagctttgcttgctggcagtccaatcccagtgta
ggaaagtttatggaaaagatgggatttgggagggattttacaaaactggagtcattctat
atggagagcataatgaacataacggccgctctcaacaaaacctccattgtttggcaggac
gtgtttgactaccatgaacgaattccacagggcacggttctggagatctggaagggtgaa
acttaccagaccgaactgagtaagatgaccaaggctgggcacagggttctgctctctgcc
ccctggtacatcaaccacatcacctacggccaggactggcgcaactcctacgccgtgcag
ccgcagaatttctccgggacagaggagcagaaaaagttggtgattggtggagaggtcgcc
atgtggggagaatatgttgatgccaccaatctaaacccacgtctatggccaagagcttgt
gctgctgctgagagattgtggagcaatgaagaaaagactctgaatgcagatctggccttc
cctcgcctggaagagtttcgctgcgaacttgtaaggcgagggattcaagcggagcctctg
tttgtcggtcactgtaaacacgagtttaatggtctgtaa

DBGET integrated database retrieval system