KEGG   Danio rerio (zebrafish): 550474Help
Entry
550474            CDS       T01004                                 

Gene name
babam2
Definition
(RefSeq) BRISC and BRCA1-A complex member 2
  KO
K12173  
BRCA1-A complex subunit BRE
Organism
dre  Danio rerio (zebrafish)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    550474 (babam2)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    550474 (babam2)
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   BRISC complex
    550474 (babam2)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    BRISC complex
     550474 (babam2)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-A complex
     550474 (babam2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
17
AA seq 386 aa AA seqDB search
MNSLSPELALSRISPELRPLLCSIVRNGRVGLDSSSCLRITDLKSGCTSLMPGPCCDRFK
LHIPYAGETLKWDIIFNARDPELPPDFIFGEDADFLPEPSELPNLVSWDSGKPECLLLLV
KEMLQQYHQYQCQRLRDSSRLLFEYDSLLEDPNYGRNMEIYAGRKNSWTGEFSARFLLKL
PVDFSNIPIYLLKDTALDPGEDVALLSVSFEDAEATQVFPKLYLSPSIEHALGGSSALHI
PAFPSGGCLIDYVPQVCQLLTNKVQYVIQGYHKRREYIAAFLSHFGMGVVEYDAVGFTKL
TLLLMWKDFCFLVHVDLPLYFPRDQPTLTFQSIYHFTSSGQLYSQVQKSYPYSPRWDGNE
MAKRAKAYFKSFIPQFQEGAFANGKL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtctctctccagagttggcattgagccgtatttctcctgagctgcggccttta
ctctgctctatagtgaggaatggacgggttggtttggattcatccagctgtctccggatt
actgacctcaagagtggctgcacatcactgatgcccggtccttgctgtgacagatttaaa
cttcatattccatatgctggagagactctcaaatgggacatcatctttaacgccagagac
ccagaactgcccccagactttatcttcggagaagatgccgactttcttcctgaaccatct
gaactcccgaacttggtttcatgggactcgggtaaaccggagtgtctcctgctgctggtg
aaggagatgctgcagcagtaccatcagtaccagtgccagcggctgcgagacagttcccgt
ttgctctttgaatacgacagcctgctcgaagacccaaactatggacgtaatatggagatc
tatgctggacgcaagaacagctggacgggggagttttctgctcgtttccttctcaagctc
cctgtggattttagcaacattcctatctatcttctcaaggacacagcactggatccagga
gaggatgtcgctcttttgtctgtcagctttgaagatgcggaagccacacaagtctttcca
aaactctacctatctcccagcattgagcatgctcttggcggatcttcagccttacatatc
ccagcatttcccagtggaggatgccttattgactacgtgcctcaagtgtgccaattactc
acaaacaaggttcagtatgtcattcaaggatatcacaagaggagagaatacattgctgct
tttctcagtcactttggcatgggtgtggtggagtatgatgctgttggctttaccaagctc
acccttctgcttatgtggaaagacttctgcttcctggtccatgtggatctgcctttgtac
ttccctcgagatcagcccaccctgacgtttcagtccatctatcacttcaccagcagtggg
cagctctactctcaggtgcaaaaatcctacccctacagtccacgctgggatgggaacgag
atggccaaacgagccaaggcttacttcaagagctttatccctcagttccaagagggggct
tttgccaatggaaagctgtag

DBGET integrated database retrieval system