KEGG   Danio rerio (zebrafish): 550507Help
Entry
550507            CDS       T01004                                 

Gene name
bdh2, zgc:110323
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dre  Danio rerio (zebrafish)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    550507 (bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    550507 (bdh2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     550507 (bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 245 aa AA seqDB search
MGRLDGKVIVLSAAAQGIGKASAIAFAKEGAQVTATDINGEKLKELDGIPGIKTKVVDVT
KKDQVDALAKDFDHVDVLFNIAGFVHHGSILDCEESDWDFTMNVNVRSMYLMIKAFLPKM
LARKSGNIINMASVASSIKGVVNRCVYSTSKAAVIGLTKSVAADFLEQGIRCNCICPGTV
DTPSLRERIQARPDPEQAFKDFMARQRTGRLCTAEEVAHLCVYLASDESTFVTGTEVIID
GGWRL
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtctggacgggaaagtgatagttctatcagcagcagcacaaggcattggaaaa
gcatctgctatagcttttgccaaagaaggtgctcaagtcactgctacggatatcaatgga
gagaaactgaaagagctggacggcattccaggaatcaaaaccaaagttgttgatgttacc
aagaaagaccaagtcgatgctcttgccaaggactttgaccatgtggatgtgctcttcaat
attgctggatttgttcatcatggctcaatactggactgtgaggaatcagattgggacttc
accatgaatgtgaatgtccggagcatgtacctgatgatcaaggccttcctgcctaagatg
ctggctcgtaaatctgggaatatcatcaatatggcatctgtggcatctagtatcaaagga
gtggtgaacagatgtgtctacagcacatctaaagctgccgtcattggactaactaaatct
gtggcagctgatttcctggaacaaggcatccgctgtaattgcatctgcccaggaactgtg
gatacgccatcattacgcgagaggattcaggccaggcctgatccagagcaggcttttaaa
gactttatggccagacagaggaccggtcgattgtgcactgcagaggaagtggcgcatctg
tgtgtgtacttggcttcagatgagtctacctttgtaacgggaacagaagtcatcattgat
ggaggatggagactatga

DBGET integrated database retrieval system