KEGG   Danio rerio (zebrafish): 550549Help
Entry
550549            CDS       T01004                                 

Gene name
eif4e1c, eif4E-1C, fb57e09, wu:fb57e09, zgc:110154
Definition
eukaryotic translation initiation factor 4E family member 1c
Orthology
K03259  
translation initiation factor 4E
Organism
dre  Danio rerio (zebrafish)
Pathway
RNA transport
mTOR signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:dre03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:dre04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:dre04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 213 aa AA seqDB search
MATSEPRGTETEEVRSDSPTAVVTTSPEQYIKHPLQNRWALWYFKNDKSKSWTENLRLIS
KFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHN
DLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYK
ERLSLPSKTLIGYQSHDDTSSKSGSTTKNMYSV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcgacttcggagccgcgaggaactgaaactgaagaagtccgctctgatagtcctacg
gctgttgtgacgacaagtcctgaacagtacatcaaacaccctttgcaaaacagatgggcc
ctctggtatttcaaaaatgacaagagcaaaagttggacagaaaacctgcgtctcatctcc
aagtttgacacagtggaagatttctgggcattatacaatcacatacaacagcccagtaag
cttggatttggctgtgattactgcttatttaaggatggtattaaacccatgtgggaggat
gataggaataaactgggtggacggtggttaatgaccctcagcaaacagcaacggcacaac
gaccttgaccgctactggatggagaccctgttgtgtttaatcggagagtcctttgacgag
gccagtgaagatgtgtgtggtgctgttgtcaatgtcaggccaaaaggggataaaatagcc
atttggacaggcaactgccaaaacagggacgcaatcatgacgatagggcaacaatacaaa
gagcgtttgagtctcccaagcaaaaccctcatcggataccagtcacatgacgacacctct
agcaaaagcggctctacaacaaagaatatgtactctgtttga

DBGET integrated database retrieval system