KEGG   Danio rerio (zebrafish): 552981Help
Entry
552981            CDS       T01004                                 

Gene name
gpx7
Definition
(RefSeq) glutathione peroxidase 7 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00480  Glutathione metabolism
dre00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    552981 (gpx7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    552981 (gpx7)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     552981 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 552981
NCBI-ProteinID: NP_001018337
ZFIN: ZDB-GENE-050522-419
Ensembl: ENSDARG00000091511
Vega: OTTDARG00000034123
UniProt: Q502E1
Position
23
AA seq 186 aa AA seqDB search
MGMFLRAFTLIILLCLLEAKQKDFYTFKVVNSRGRLVSLEKYRGSVSLAVNVASECGYTD
EHYKDLQQLQKDFGPFHFNVLAFPCNQFGQQEPGSDKEIDSFVRRVYGVSFPIFSKIAVV
GIGANNAYKYLVEASRKEPTWNFWKYLIDTDGKVVDAWGPEVSVKEIRPRITEMVRKLII
KRKEEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtttctgagggcgtttactttaatcattttattatgtctgctagaggccaaa
cagaaagacttttacacgtttaaagtggtaaacagcagaggccggttagtttctctggag
aaatacagaggatcggtgtctctggcagtgaatgtggccagtgaatgcggttacacagac
gagcactacaaagaccttcagcagctgcaaaaagacttcggcccgttccatttcaacgtc
ttggcttttccctgtaaccagttcggtcagcaggagcccggcagcgataaagagatcgac
agcttcgtgcgcagagtctacggggtttcctttccaatcttcagcaaaatagctgttgtg
ggtattggggcaaacaatgcttacaaatacctcgtcgaggcgtctagaaaagagccgacc
tggaatttctggaagtacctcattgacaccgacggcaaagtcgttgatgcttggggtccc
gaagtctccgtcaaagaaattcgcccacggatcacggagatggttcggaagttgatcatc
aagaggaaagaagagctgtaa

DBGET integrated database retrieval system