KEGG   Danio rerio (zebrafish): 552981Help
Entry
552981            CDS       T01004                                 

Gene name
gpx7, im:6902827, zgc:112293
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dre  Danio rerio (zebrafish)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dre00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dre00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
23
AA seq 186 aa AA seqDB search
MGMFLRAFTLIILLCLLEAKQKDFYTFKVVNSRGRLVSLEKYRGSVSLAVNVASECGYTD
EHYKDLQQLQKDFGPFHFNVLAFPCNQFGQQEPGSDKEIDSFVRRVYGVSFPIFSKIAVV
GIGANNAYKYLVEASRKEPTWNFWKYLIDTDGKVVDAWGPEVSVKEIRPRITEMVRKLII
KRKEEL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtttctgagggcgtttactttaatcattttattatgtctgctagaggccaaa
cagaaagacttttacacgtttaaagtggtaaacagcagaggccggttagtttctctggag
aaatacagaggatcggtgtctctggcagtgaatgtggccagtgaatgcggttacacagac
gagcactacaaagaccttcagcagctgcaaaaagacttcggcccgttccatttcaacgtc
ttggcttttccctgtaaccagttcggtcagcaggagcccggcagcgataaagagatcgac
agcttcgtgcgcagagtctacggggtttcctttccaatcttcagcaaaatagctgttgtg
ggtattggggcaaacaatgcttacaaatacctcgtcgaggcgtctagaaaagagccgacc
tggaatttctggaagtacctcattgacaccgacggcaaagtcgttgatgcttggggtccc
gaagtctccgtcaaagaaattcgcccacggatcacggagatggttcggaagttgatcatc
aagaggaaagaagagctgtaa

DBGET integrated database retrieval system