KEGG   Danio rerio (zebrafish): 553250Help
Entry
553250            CDS       T01004                                 

Definition
zgc:152808 (EC:5.3.4.1)
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     553250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
24
AA seq 484 aa AA seqDB search
MALLRAVVSSVLLSRVLLALVLDLDDSFKDSRMEDVWLVDFYAPWCGYCKKLEPVWEEVG
AELSRSGSPVRVGKMDATAYSGMASEFGVRGYPTIKLLKGDLAYNYKGPRTKDDIIEFAN
RVAGPAVRALPSRQMFEHVLKRHSVLFLYVGGESPLKEKYIEVASELIVYTYFFSASEEV
LTEAVVLPELPSVVVFKDASFFTYDEYEDGSLSSWVNRERFQSYLQIDGFTLYELGETGK
LVAIAVTDDKDQSDHSSRLKGLIQRVATEHREQFNRDFQFGHMSGNDYINSLIMGEVSIP
SIIILNTSNEQYFLPAEPVEDLQQMLQFFSSVLDGSAPAYGGDGIFQRIKRVAYDARSTI
MSVFRSSPLLGCFLFGLPLGVISLMCYGICTAESDDGTEDLELMKAEEEEEEEERLTERT
EEEEEQTDRTAEEELTESGVVCVAPPSASGAERVDELWQCVLTVTLTCVSVLHHVSPVNV
RAAN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctgagagcggttgtgtcctctgtgctgctcagccgggtgctgctggcgctg
gtgctggacctcgacgactcgtttaaggacagcaggatggaggatgtgtggctggtggat
ttctacgcgccgtggtgtggctactgtaagaagctggagccggtgtgggaggaggtcgga
gctgagctgtcgcgctcgggctcgccggttcgagtggggaaaatggacgccactgcatat
tcaggaatggcgtcagagttcggtgttcggggatatcccacaatcaaactgctgaagggg
gatctggcttataattataaaggaccaagaactaaagacgacattatcgagttcgccaat
agagtggctgggccggctgtgcgtgcactgccgagcagacagatgtttgagcatgtgctg
aagagacacagtgtgctgttcctgtatgtgggaggagagtctccgctgaaggagaagtac
atcgaggtggcgtcagagctcatcgtgtacacgtatttcttctctgcgtctgaggaggtc
ttgacggaggctgtggttctgccagagctgccctccgtcgtcgtcttcaaagatgcctcg
ttcttcacgtatgacgagtatgaggacggcagtttgtcctcctgggtgaaccgagagcgc
ttccagagttacctgcagatcgacggattcacactgtatgagctgggggaaaccgggaaa
ctggtggccatcgcagttacagacgacaaagaccagagcgatcacagcagcaggctgaaa
ggtctcatccagagagtcgctactgaacacagggagcagtttaacagggattttcagttt
ggacacatgtctgggaacgactacatcaacagcctcatcatgggcgaggtgtccattccc
agcatcatcatcctcaacacctctaatgagcagtactttctgcctgcggagcccgtggag
gatctccagcagatgctgcagttcttcagcagtgttctggacggcagcgctccggcgtac
ggaggagacggaatattccagaggatcaagcgtgtggcgtatgatgccagatccaccatc
atgtctgttttccgcagttctcctctgctgggctgtttcctcttcggcctgccgctcggg
gtcatcagtctgatgtgttacgggatctgcacggccgagtctgacgacgggacggaggat
ctggagctgatgaaggctgaggaggaggaggaggaggaggagcggctgacagagagaaca
gaagaagaagaggagcagacggacagaacagcagaagaagagctgacggagagcggggtg
gtgtgtgtcgctcctccatctgcgtctggtgctgaacgtgtggacgagctctggcagtgt
gttcttactgttactttaacgtgtgtttcagttcttcatcatgtttctcctgtaaatgta
cgagctgcaaactaa

DBGET integrated database retrieval system