KEGG   Danio rerio (zebrafish): 553353Help
Entry
553353            CDS       T01004                                 

Gene name
si:ch211-202f3.3
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  
calpain-1 [EC:3.4.22.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Necroptosis
Cellular senescence
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    553353 (si:ch211-202f3.3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    553353 (si:ch211-202f3.3)
   04217 Necroptosis
    553353 (si:ch211-202f3.3)
   04218 Cellular senescence
    553353 (si:ch211-202f3.3)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     553353 (si:ch211-202f3.3)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C2: calpain family
   553353 (si:ch211-202f3.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
ZFIN: 
Ensembl: 
Vega: 
Position
17
AA seq 846 aa AA seqDB search
MSLDYVGKPEHLEEAHAITTGKLNLGAHPGSVAVDFDIAGNSSSSDFFKPTANNFSSMND
GGTGSMQSALSDLSSISTAPKTFGISELDASTINTLTSGVFWCGAGLLPAFLKPEVGQKS
AKASHRQRRRRLLWVKFLNLAFKDFKMPPPVVPHGMCLKVMNDRNMKGGMGSDTNPLKFM
DQDYNFLQDYCLKTRQRFVDEFFPPDLRSIGEGLLKPEVMARVEWIRPTKLYPEAAEFVV
DTVSRFDYAQGFIGNCWFLASVGALTFQSKLLQKVVPDGQSLRHNYTGLFHFRFWRFGKW
FDVVIDDKLPTINRQLIFVKSKTYNEFWPALLEKAYAKVCGSYADMHTGRVSEALLDFTG
GVHMHYDLKTAPTDLWEIMYRASQSEVLMGCESPAGNEERLPNGIVLGHAYTVTKVYQVM
SGRNPVQLVRLFNPWGDSEWNGDWSDNSPLWNTVDDEDRKQLLVSDNGEFWMSMKDFLRT
FDNMDICCNCPDFLEGKSACKWTSKSHNGSWVPGSTAGGCMNHPDTFCTNPQFWLRINEM
DKTCDQGQNNVLVSLIQKPDKRNRRLAQHHGIGFCVFAVPPEMRSEGKFRSSFFNRKPVV
TSGNFQDARQVMKFFRLEPGEYLIVPSTYLPNKNADFILSILCKNDIQIQKDTERTEKDF
LVDLIGVSESGCTEKEDEESKTKFLFRQYSDQYKVVDAEKLQQILHENLLRGRKNAEGFG
LDSCRSMIAMSDFCVTGRLQGSEFVRLWDRITTYRDIFYNMDSSKDGVLSLNELQNALEK
TGLHLNEDILNLMVVRYGGASEQISLEGFICLVMRLNCMASIFQKLCENGKISLDESEWI
GLTMYS
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggactatgtggggaaaccagagcaccttgaagaagcccacgcaatcacgaca
gggaagttgaacttgggggctcatccgggatctgtagcagttgactttgatattgctggc
aatagttcaagctctgacttcttcaaaccgactgccaacaacttttcatccatgaatgac
ggtggaacgggatccatgcaatcagctctgtcagatttgagttccatctccacagctccc
aaaactttcggtatctccgaactagatgcatcaaccataaacacactcacttccggtgtg
ttttggtgtggggcggggcttctgcctgcatttttaaagcctgaagtggggcaaaagagt
gcaaaagccagtcatagacagagaagacgacgactcctttgggtgaaatttctcaacctt
gcatttaaagattttaaaatgcctcctccagtggttcctcatggcatgtgcctgaaggtt
atgaatgaccgtaacatgaagggcggcatgggctctgacacaaatccactgaagttcatg
gaccaagactacaacttcctgcaagactactgtctcaagacaaggcagagatttgttgat
gagtttttcccaccagaccttcgttccattggcgaagggctgctgaagcctgaggtcatg
gcccgagtggagtggattagaccaacgaaattatatccagaagctgctgaattcgttgta
gatacggtgtccaggtttgactatgcccaagggtttataggaaactgttggtttctggcc
tctgttggtgccttaacatttcaaagcaaattactgcaaaaggttgttccagatggacag
tcactcagacacaattacactggcttatttcacttcaggttctggcgctttggaaaatgg
ttcgatgtagtgattgacgacaagctgccaacaatcaatcgccagctgatctttgtcaaa
tctaaaacatataatgagttctggccagccttgctggagaaagcatatgccaaggtatgt
ggctcctatgctgacatgcacaccggccgagtgtctgaggccctgctggacttcactggc
ggggttcatatgcactacgatctgaaaacggctccgactgatctgtgggagataatgtac
cgtgcttcccagtcagaggtccttatgggctgtgaaagcccagcagggaatgaggagcgg
ttaccaaatggcatagttctgggccacgcttacactgtgacaaaggtctaccaggtcatg
agtggtagaaatcctgttcagctggtgagattgttcaacccatggggagacagtgagtgg
aatggagactggagtgacaattcacctttatggaacacggtcgatgatgaggaccgcaaa
cagcttctcgtatctgataatggagagttctggatgtcaatgaaagatttccttagaaca
tttgacaacatggacatctgttgtaactgtcctgattttctggaaggaaagtctgcatgc
aagtggacctccaagtcccacaacggcagctgggttcctggaagtacagctggaggctgc
atgaaccacccagacaccttctgcaccaacccccagttctggctgagaattaatgagatg
gacaagacgtgtgaccaaggccaaaacaatgttctggtgtccctcatacagaaacctgac
aagaggaacagacgtctggctcaacaccacggaattggcttctgcgtgtttgcggttcca
ccagagatgagatctgagggaaagttcagatcaagcttttttaatagaaagcctgtggtg
acaagtgggaactttcaggacgcaagacaggtgatgaagttcttcaggctggaaccagga
gagtatctcattgtaccgtccacttacttgcctaataagaacgcagatttcattctgtcc
atcctctgcaagaatgacatccagatacaaaaggacacagaaagaacagagaaagatttt
cttgtggatcttattggagtgtctgagtctggttgcacagaaaaggaggatgaagagtca
aaaacaaaatttctgtttcgacagtattctgatcagtacaaagttgtggatgctgagaaa
ctccagcagattcttcatgaaaatctgcttagagggagaaaaaatgctgaaggatttggg
ctggattcctgtagaagtatgattgccatgtcagatttttgtgtcactggaagacttcag
ggatcagaatttgttcgtctgtgggaccggattacaacctacagggacatcttctacaac
atggactcttctaaagatggtgttctgtctttgaatgaacttcaaaatgcattagagaaa
acaggcctacatctaaacgaagacatcttgaatctcatggtggtgcggtacggtggtgca
tctgaacagatctcgttggagggattcatatgccttgtcatgcgtttgaactgcatggcc
agcatatttcagaaactctgtgaaaatgggaagataagtcttgatgagagtgagtggata
ggactcaccatgtactcatga

DBGET integrated database retrieval system