KEGG   Danio rerio (zebrafish): 553401Help
Entry
553401            CDS       T01004                                 

Gene name
hadhaa, cb1055, hadha, im:7136067, wu:fa14c08
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit a
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    553401 (hadhaa)
   01212 Fatty acid metabolism
    553401 (hadhaa)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    553401 (hadhaa)
   00650 Butanoate metabolism
    553401 (hadhaa)
  Lipid metabolism
   00062 Fatty acid elongation
    553401 (hadhaa)
   00071 Fatty acid degradation
    553401 (hadhaa)
   01040 Biosynthesis of unsaturated fatty acids
    553401 (hadhaa)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    553401 (hadhaa)
   00310 Lysine degradation
    553401 (hadhaa)
   00380 Tryptophan metabolism
    553401 (hadhaa)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    553401 (hadhaa)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     553401 (hadhaa)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     553401 (hadhaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
20
AA seq 761 aa AA seqDB search
MASARLLLARGCTGVKSSFTGHGQRSLSVSSAVLARTHVSYEVKDNVAVVRINDPTSKVN
TLSKHMQAEMVEVMNEVWGNSSVKSAVLISRKPGCFIAGADINMIQACTTAEEVTSLSQA
GQKMFEQIEKSPIPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGTPEVMLGLLPGA
GGTQRLPKMVGLPAAFDMMLTGRNIRADKAKKMGLVHQLVDPLGPGLKSPEERTIEYLEE
VAVDFAKGLAAKKVTLEKKKGLMQKVQDFVMGLSLVRQQIYKTVHGKVMKQSKGLYPAPL
KIIECIQTGIEKGNAAGYLAEAQNFGQLAMSSESRALIGLYHGQVACKKNHFGKPEREVK
NLAILGAGLMGAGIAQVTIDKGVATILKDTTLEGLARGEQQVYKGLNDKTKKKSLTTFER
DGIMSKLSGQLDYHGFEKADMVIEAVFEDLAIKHKVLKEVEAVIPPHCIFATNTSALPIK
DIAAASKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTASAVAIGLKQGKLIVVVGDG
PGFYTTRCLAPMLAEAVRILQEGVGPKKLDSLTTGFGFPVGLATLADEVGIDVAAHVAED
LGKAFGARFGGGNVDFLKTMVQKGFKGRKSGKGCYVYGAKSKEKKVNSEAEEILKSFKLT
APPAVSSDEDIQYRLVSRFVNEAVLCLQEGILADPIQGDIGAVFGLGFPPCLGGPFRFVD
SYGADKLIQKMKRFEEVYGNQFSPCQLLLDHAKNTSKRFHK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgcaagactcttgttggctcgaggctgcactggcgtgaaatctagtttcaca
ggtcatggacagagatctctctccgtatcatcggctgtgctggcgcgcactcatgtcagt
tatgaggtcaaggataatgtggctgtggtgagaatcaatgatcccacctcgaaggtgaac
actctgtccaagcacatgcaggctgagatggtggaggtgatgaatgaagtttgggggaat
tcatcagtaaagagcgccgtcctcatctccagaaaaccaggatgcttcatcgcaggagcc
gatatcaatatgattcaggcctgtacgacagcagaggaagtgacctcactctcacaggcg
ggacagaagatgtttgagcagattgagaagtcaccaatccctattgtggctgccataaac
ggctcctgtctgggcggaggactggagtttgctattgcgtgtcagtaccgcattgccact
aagagtaagaagacagttctgggcaccccagaggtgatgctgggtctgctgcctggcgcc
ggaggcactcagaggctgcctaaaatggtcggtcttcctgctgcgtttgatatgatgctg
actggcagaaacatacgggcggataaagccaagaaaatggggctcgtccatcagctggtg
gatcctctgggtcccggattgaagagtccagaagaaaggacaatcgagtatctggaggaa
gtggctgttgattttgctaaaggtctcgctgctaaaaaagtcaccttggaaaagaagaaa
gggctcatgcagaaggtgcaggattttgtgatgggtctgtcactggtccggcaacagatc
tacaaaactgtccatggcaaagtcatgaaacagagtaaaggtctttatcctgcaccgctg
aagattatagagtgtattcagaccggcattgaaaaaggaaacgctgcaggatacctggct
gaagctcagaacttcggtcagctggcgatgtcatcagaatccagagctctgattggtctt
tatcatggtcaggtggcctgcaagaagaaccacttcgggaagccggagagagaagtgaaa
aatctggctatcctaggggcggggcttatgggagcgggaattgcccaggtgaccatagac
aagggtgtggccactattttaaaggacacgacactggaaggcctcgccagaggtgaacag
caggtgtacaaaggacttaatgacaaaaccaagaagaagagtctgacgacgttcgagaga
gatggcatcatgtcaaagctgtcaggacagctggattaccacggctttgagaaagcagac
atggtcatcgaagcagtgtttgaagacctggccataaaacacaaagtgctaaaggaggtt
gaggctgtgattcctcctcactgtatctttgccaccaacacatctgctctgcccattaaa
gacatcgcagctgccagtaagaggcctgagaaggtgatcgggatgcattatttctctcct
gtggataaaatgcagctgctggaaatcatcaccaccgacaaaacctccaaagacaccacc
gcgtctgccgtggccatcggactcaaacaggggaagctcatcgtagtagtgggggatggt
ccagggttttacaccactcgctgtctggcacccatgttagctgaagcggttcgaattctt
caggaaggagtcgggcccaagaaactggattccctgacaacaggattcgggtttcctgtg
ggcttagcgacacttgctgacgaggtcggtattgacgtggcggctcatgttgcagaggat
cttggcaaggcttttggagcgcggttcggaggaggaaatgttgacttcttgaagaccatg
gtgcaaaaagggttcaaaggacgcaagtctggaaagggttgttatgtgtacggagccaag
tcaaaagaaaagaaagtgaactcagaagctgaagaaattctcaagagcttcaagctaaca
gcgccccctgctgtctccagcgatgaggatattcagtacagactcgtgtctcgatttgtg
aacgaggccgtgctgtgtctacaggaaggcattctggccgaccccattcagggagatatt
ggagctgtgtttggacttggattcccgccttgcttgggaggtccgttccgttttgtggat
tcttacggcgcagacaaacttatccagaaaatgaagcgctttgaggaggtttatggtaac
cagttcagtccctgccagcttctccttgatcacgctaaaaacaccagcaagaggttccac
aagtga

DBGET integrated database retrieval system