KEGG   Danio rerio (zebrafish): 553520Help
Entry
553520            CDS       T01004                                 

Gene name
rasgrf2b, rasgrf2, rasgrf2-2
Definition
Ras protein-specific guanine nucleotide-releasing factor 2b
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    553520 (rasgrf2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
5
AA seq 1244 aa AA seqDB search
MQKSVRYNEGHALFLSVIARKEGTKRGYLSKKTTENSKWHEKFFALYQNVLFYFDTDQSA
RPSGIYLLEGCTCERVPALKVSTVGKDALDKLQYFLVVFGHDGQKPLELRTEEESDCDEW
VEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIA
LNKTKERMRPYHVFQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPDANDEDAKNSG
QVFGHLDFKIVVEPSDAPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNT
FLHTYRIFTTATVVMEKLADIYKKPFTSIPVRSLELFFATNQNNRSGDHVNDKSPRLCRK
FSSPPPLSISSRTSSPVRTRKLSLNSPIGSKVGILDLSTTSSSAASSPTSANPTISPPPS
NNNNNSKPPLDLSRGQSPSSPEQSPGALDDNAEVPRIDALCGKLRRSIRRAVLESVSLDK
FIPESPQASEPGEISPCRSPSTPRHLRYRQSGVQTAENSRCSVSPASAFAIATAAAGHSS
PPVFNNSERTCDKEFIIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMGVICLLEEVLRD
PDLLPQERKATANILSALSQDDQDDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLL
DHIVFRSIPYEEFLGQGWMKTDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRAGS
IEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDKLQKTVSSE
GRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIR
QFQQTPYRIEHQPKVTQYLLDKTLIMDEDTLYDLSLKIEPRLPA
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagtgttcggtacaatgagggacacgctttgtttctctccgttatcgcgcgt
aaagagggcaccaagcgaggctatctcagcaagaagaccacggaaaacagcaaatggcac
gagaagttttttgcactttatcagaatgttttgttttacttcgacaccgaccaaagtgct
cgaccatcagggatttatcttctggagggatgcacatgtgaacgggtccctgcgctcaag
gtgtccactgttggcaaagacgcacttgacaagctgcaatatttccttgtggtcttcggc
catgatggacagaagcctctggagctacggacggaagaagagtctgactgtgatgaatgg
gttgaagccatccagcaggccagctactctgatatcatcatcgagcgtgaggttctcatg
cagaaatacatccacctggtgcaaatcgtggagacggagaaagtggcagcaaaccagctc
cgcacacaactggaggaccaagacactgagattgagaggcttaaagctgagattatagcc
ttgaacaaaaccaaggaaagaatgcgcccctaccatgtatttcaagaagaggaagatcct
gatataaaaaaaattaaaaaggtccagagcttcatgcgagggtggctgtgtagaaggaag
tggaagattattgtgcaggactacatctgttctcctcatgctgagagcatgaggaagagg
aatcagatcgtcttcaacatggtggaggctgagactgagtacgtccatcagctttccatt
ttagtcaactgcttcctgaggccactcagaatggccgccagctccaagaaaccacctata
agccatgatgatgtcagtagcatattccttaacagcgagacaatcatgtttctacatgaa
atattccatcagggattgaaggcgaggatagcaaactggcccacgctggttctagcggac
ctctttgatatcttgctgccaatgctgaacatctatcaggagtttgtgaggaaccaccag
tacagtcttcaggttcttgcaaactgcaaacagaaccgggactttgataaactcctgaag
cagtatgaatccaatgctgcgtgtgagggacggatgctggaaacattcctcacatacccc
atgtttcagatccctcgttacatcattactctccatgagctattggctcatactcctcat
gagcatgtggaaaggaaaagtctagaatttgccaagtccaaactggaggagctttccagg
gtgatgcacgatgaagtaagtgataccgaaaacatccgtaagaacctggctattgagcgc
atgatcgtggagggctgcgacatcctccttgacaccagccagacgtttgtgagacaaggc
tctttgatccaattgccctcagtggagcgagggaagctcagtaaggtgcgactcggctct
ctctcgctcaaaaaggaaggagaaagacagtgcttcctttttaccaagcacttccttatc
tgcacacgcagctcaggaggcaaacttcacctgctcaaacaaggtggtgtgctgtccctg
attgagtgcactctcatcgaagagcctgatgccaatgacgaggatgctaagaattcaggg
caggtgttcggtcaccttgactttaagattgtggtggagccttcagatgctccggccttc
actgtggtgctactggcaccatcccgtcaggagaaagcagcttggaccagcgacatcagc
cagtgcatcgataacatccgctgcaatggcctgatgaccagtgtgtttgaggagaactca
aaagtcacagtacctcatatgatcaaatctgatgcgcgtctccataaagatgatgttgac
atttgcttcagtaagaccctcaactcctgcaaggttcctcagatccgctacgccagcgtg
gagagactgctggagaggttgaccgacctgcgcttcctctccatagacttcctcaacaca
ttcctgcacacctaccgcatcttcactactgccaccgtggtcatggagaaactggctgac
atctacaagaagccttttacttccataccagtcagatccttggagcttttctttgccacc
aatcagaacaaccgcagcggggaccacgtcaatgacaaatctccaagactgtgccgcaag
ttctcatcccctccacctctctccatttcctctcgtacttcctctccagttcgcactaga
aaactctctcttaattcacctattggctcaaaagtaggcatccttgatctgtccaccact
tcatcatctgcagcaagcagtccaacctccgccaaccccaccatctcacctccaccatcc
aacaacaataacaacagcaagccacctttggatcttagccgtggacagagtccttcctcc
cccgagcagagtcctggagctctggacgacaatgcagaggtgccaagaatcgatgccctt
tgtggtaaactacgccgcagcataaggagagctgtgctggagtcagtgtctttggacaaa
tttattccagagtcgccccaggccagtgaaccaggagaaatctctccgtgccgctcaccc
tccactccacgccacctccgctacagacagtcaggagtccagacggctgagaactcacgc
tgctctgtttctccagcctctgcgtttgccatcgccactgcagcagctggacacagcagc
cctccagtttttaacaactctgagaggacttgtgacaaggagttcattatacgtcgagcg
gctactaacagagtcctgaatgtcttgcgacactgggtctccaaacactcacaggacttt
gaaatgaatggagagttgaagatgggtgtgatctgcctgctggaagaggtgttgagagac
ccagaccttctccctcaggagagaaaagccacagcaaacatactaagtgccctttctcaa
gatgaccaggatgatgcacagctgaagattgaagacattcttcagatggctgagtgccca
aaggccgagtgttttgagtctctgtctgcaatggagatagcagaacaaatcactctcctc
gatcacatcgtgttcaggagtattccctacgaggagttcctgggccaaggatggatgaag
acagataagacagagagaacgccatacatcatgaagacaagtcaacacttcaatgacatg
agtaatctggtggcctctcagatcatgagccatacagatgtgggctccagagcgggttct
attgaaaaatgggtcgcagtggctgacatttgccgttgtctcaacaattataacggtgtc
ttggagatcacatctgccctgaaccgcagcgccatctacaggctgaagaagacatgggct
aaagtctgcaaacagactaaagcactaatggacaaacttcagaagaccgtgtcatctgag
ggaagatttaaaaacttgagggaaactctcaaaaactgtaatccaccctgtgttccatat
ctgggcatgtacttgacagaccttgcgtttatcgaagagggaactccaaatttcacagag
gaaggtctagttaacttctcaaagatgagaatgatttctcacatcatacgagagatccga
cagttccagcaaactccctacagaatagagcaccaaccaaaggtcacgcagtatcttctg
gataagaccttgattatggatgaggacacactttatgatttatcactcaagattgaaccc
aggcttcctgcatga

DBGET integrated database retrieval system