KEGG   Danio rerio (zebrafish): 553685Help
Entry
553685            CDS       T01004                                 

Gene name
cyb5r4, im:4727699, zgc:112177
Definition
cytochrome b5 reductase 4 (EC:1.6.2.2)
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
16
AA seq 527 aa AA seqDB search
MLNVPSQAFPAAGSQQRVAPAGQSRNKVVLKPGHSLLDWIRLTKSGQDLTGLRGRLIEVT
EDELKKHNTKKDCWTCIRGMVYNLSAYMDFHPGGEEELMRAAGIDSTDLFDEVHRWVNYE
SMLKECLVGRMAVKPSPALQAHTEKTESTHLNGLSAPPSLRPEPLSAPLPAKDHRPRYDW
FQTDGTVNIVVYTKRKIPSAGCAVVDLQDDNLRVEMLLGRMSYLLYWRLSSRVQDHVDVQ
TAHSVGKVQLCLRKSVKEKWTQLGQSLEHHDTFIQCKDRGLFYRECVLLSKTDVTHNTQL
LRLQLPRGSRMQVPVGRHVYLKTSVQGTDVVKPYTAVDQMLIPPSQSSAEVGSDIHLMIK
VYPDGVLTPHIANLPIGASLSVGGPEGSFTLRVLRDVTHLYMLAAGTGFTPMARLIRLAL
QDFTVIRKMKLMFFNRQERDILWQSQLDELCTKEERFEVQHVLSEPADSWTGRRGRIDAC
MLQNFLERPENSKCLVCVCGPAGFTESAVQLVRQLDFSEEELHVFQA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgtcccatctcaggctttccctgctgctggatcccagcagagagtcgcgcca
gccggacagtccagaaacaaggtggtgctgaagcctggtcacagtttgctggactggatc
cgactgaccaaaagtggacaggatttaacaggactgagaggtcgactgatcgaggtcaca
gaagacgagctgaagaaacacaacaccaaaaaagactgctggacgtgcattagaggtatg
gtctataacttgagtgcctacatggatttccaccctggtggggaagaggagttaatgcgg
gctgctgggattgatagcactgacctgtttgacgaggtccaccgatgggtgaattatgag
tccatgctgaaggagtgtttggtggggaggatggcagtaaagcccagccctgctctacaa
gctcacacagagaagactgagagcactcatttaaacggtttatctgcgcctccatcttta
agaccagagcctttatctgctcctcttcctgccaaagaccatcgtcctcggtatgattgg
ttccagacagatggcacggttaatattgttgtttacaccaagcgaaagattcccagcgcc
ggctgtgcagtggtggatctacaggatgataatctcagagtagagatgctgttgggcagg
atgtcgtaccttctctactggcgcctgtccagtagagttcaagatcatgttgatgtgcag
acagcccactctgttggaaaggttcagttgtgcctgcgcaaatccgtcaaagaaaagtgg
acgcagttggggcaatcgcttgaacaccatgacacattcattcaatgtaaagatcgaggg
ctcttctacagggagtgtgtgctgctttcgaaaacagacgtcacacacaacacgcagctc
ttgcgcttgcagcttcctcgagggtcacgtatgcaagttcctgtgggaagacacgtctac
ctcaaaacgtctgtccagggtacggatgttgttaaaccctacacagcagtggatcagatg
ctaatacctccctcacagtccagtgctgaagtgggctcagacatacatctcatgataaag
gtctatccggatggagtgttgaccccgcacatcgccaaccttcctattggagcgtctctg
tctgtaggaggccctgaaggctcctttactctgcgagtcctacgggatgtcactcatctc
tacatgttagcagcgggcacaggattcacacccatggctcgtctcatccggctggccctg
caggacttcacagtgatcagaaaaatgaagctgatgttcttcaaccggcaggagagagac
atactttggcagtcacaactggatgaattatgtacaaaagaggaaagatttgaggtgcag
catgttctctcagagcctgcagactcgtggacgggcagaagaggacggatagatgcttgt
atgctgcagaacttcctggagaggccagaaaactccaagtgtttagtgtgcgtgtgcggc
cctgctggattcacagagtcagcagtgcaattggtcagacagctggacttcagtgaagag
gaactccatgtttttcaggcttga

DBGET integrated database retrieval system