KEGG   Danio rerio (zebrafish): 553685Help
Entry
553685            CDS       T01004                                 

Gene name
cyb5r4, im:4727699, zgc:112177
Definition
(RefSeq) cytochrome b5 reductase 4 (EC:1.6.2.2)
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    553685 (cyb5r4)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     553685 (cyb5r4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
16
AA seq 527 aa AA seqDB search
MLNVPSQAFPAAGSQQRVAPAGQSRNKVVLKPGHSLLDWIRLTKSGQDLTGLRGRLIEVT
EDELKKHNTKKDCWTCIRGMVYNLSAYMDFHPGGEEELMRAAGIDSTDLFDEVHRWVNYE
SMLKECLVGRMAVKPSPALQAHTEKTESTHLNGLSAPPSLRPEPLSAPLPAKDHRPRYDW
FQTDGTVNIVVYTKRKIPSAGCAVVDLQDDNLRVEMLLGRMSYLLYWRLSSRVQDHVDVQ
TAHSVGKVQLCLRKSVKEKWTQLGQSLEHHDTFIQCKDRGLFYRECVLLSKTDVTHNTQL
LRLQLPRGSRMQVPVGRHVYLKTSVQGTDVVKPYTAVDQMLIPPSQSSAEVGSDIHLMIK
VYPDGVLTPHIANLPIGASLSVGGPEGSFTLRVLRDVTHLYMLAAGTGFTPMARLIRLAL
QDFTVIRKMKLMFFNRQERDILWQSQLDELCTKEERFEVQHVLSEPADSWTGRRGRIDAC
MLQNFLERPENSKCLVCVCGPAGFTESAVQLVRQLDFSEEELHVFQA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatgtcccatctcaggctttccctgctgctggatcccagcagagagtcgcgcca
gccggacagtccagaaacaaggtggtgctgaagcctggtcacagtttgctggactggatc
cgactgaccaaaagtggacaggatttaacaggactgagaggtcgactgatcgaggtcaca
gaagacgagctgaagaaacacaacaccaaaaaagactgctggacgtgcattagaggtatg
gtctataacttgagtgcctacatggatttccaccctggtggggaagaggagttaatgcgg
gctgctgggattgatagcactgacctgtttgacgaggtccaccgatgggtgaattatgag
tccatgctgaaggagtgtttggtggggaggatggcagtaaagcccagccctgctctacaa
gctcacacagagaagactgagagcactcatttaaacggtttatctgcgcctccatcttta
agaccagagcctttatctgctcctcttcctgccaaagaccatcgtcctcggtatgattgg
ttccagacagatggcacggttaatattgttgtttacaccaagcgaaagattcccagcgcc
ggctgtgcagtggtggatctacaggatgataatctcagagtagagatgctgttgggcagg
atgtcgtaccttctctactggcgcctgtccagtagagttcaagatcatgttgatgtgcag
acagcccactctgttggaaaggttcagttgtgcctgcgcaaatccgtcaaagaaaagtgg
acgcagttggggcaatcgcttgaacaccatgacacattcattcaatgtaaagatcgaggg
ctcttctacagggagtgtgtgctgctttcgaaaacagacgtcacacacaacacgcagctc
ttgcgcttgcagcttcctcgagggtcacgtatgcaagttcctgtgggaagacacgtctac
ctcaaaacgtctgtccagggtacggatgttgttaaaccctacacagcagtggatcagatg
ctaatacctccctcacagtccagtgctgaagtgggctcagacatacatctcatgataaag
gtctatccggatggagtgttgaccccgcacatcgccaaccttcctattggagcgtctctg
tctgtaggaggccctgaaggctcctttactctgcgagtcctacgggatgtcactcatctc
tacatgttagcagcgggcacaggattcacacccatggctcgtctcatccggctggccctg
caggacttcacagtgatcagaaaaatgaagctgatgttcttcaaccggcaggagagagac
atactttggcagtcacaactggatgaattatgtacaaaagaggaaagatttgaggtgcag
catgttctctcagagcctgcagactcgtggacgggcagaagaggacggatagatgcttgt
atgctgcagaacttcctggagaggccagaaaactccaagtgtttagtgtgcgtgtgcggc
cctgctggattcacagagtcagcagtgcaattggtcagacagctggacttcagtgaagag
gaactccatgtttttcaggcttga

DBGET integrated database retrieval system