KEGG   Danio rerio (zebrafish): 553734Help
Entry
553734            CDS       T01004                                 

Gene name
scdb
Definition
(RefSeq) stearoyl-CoA desaturase b
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre01040  Biosynthesis of unsaturated fatty acids
dre01212  Fatty acid metabolism
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    553734 (scdb)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    553734 (scdb)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     553734 (scdb)
Lipid biosynthesis proteins [BR:dre01004]
 Desaturase
  First
   553734 (scdb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 553734
NCBI-ProteinID: NP_001018541
ZFIN: ZDB-GENE-050522-12
Ensembl: ENSDARG00000030265
Vega: OTTDARG00000022871
UniProt: Q501V8
Position
13
AA seq 316 aa AA seqDB search
MADVTTTTEDVFDDSYVEKPGPSPPVQIVWRNVILMTLLHLGALYGMTILPFVSSLTLIW
TGVCFMVSALGITAGAHRLWSHRSYRASLPLRIFLAVANSMAFQNDIYEWARDHRVHHKF
SETDADPHNARRGFFFAHIGWLLVRKHPEVIDKGRKLTFEDLKADSVVMFQRRHYKLSVV
VMCFLIPTLVPWFFWEESLWTAYLVPCLLRYAVVLNATWLVNSAAHMWGMRPYDHNINPR
ENKFVAFSAIGEGFHNYHHTFPHDYATSEFGSRLNVTKAFIDLMCFLGLANDCRRVTHET
ILARVQRTGDGSHKSG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtgacgacgacgacagaggatgtttttgatgattcttatgtggagaaaccg
ggcccgagtcctccggtacaaatcgtatggagaaatgtcatattaatgactctattgcac
ctaggagcgctttatggaatgacgattcttccttttgtctcttccttaaccctcatatgg
acgggagtgtgtttcatggtaagtgctctaggaataactgccggcgcccatcgcctctgg
agccaccggtcctacagggcctcactgccattacggatcttcctagcagtcgcaaactct
atggcttttcagaatgatatctatgagtgggccagagatcaccgcgtccatcacaagttt
tctgagacggatgcagacccccacaacgctcgcagaggattcttctttgctcacatcggc
tggctactggtccgtaaacacccagaagtcattgataaaggacgcaagctgacgtttgaa
gatctaaaagcagacagtgttgtaatgtttcagaggaggcattacaagttatctgtggtg
gtgatgtgctttcttatcccaaccttggtaccttggtttttttgggaggagagtctttgg
actgcttacttggtgccatgtctgctgagatacgctgtggtccttaatgcaacctggctg
gtcaacagcgccgctcacatgtggggaatgagaccctacgaccacaacatcaatcccaga
gagaacaagtttgtcgccttcagtgccatcggtgaaggattccacaactatcatcacaca
ttcccccatgattatgccacaagtgagttcggcagtcggctgaacgtgaccaaagcgttc
atcgatctcatgtgcttcctgggactggccaacgattgcagaagggtaactcacgaaacc
atcctcgcccgtgttcagcgcacaggtgacggcagccacaaaagtggttga

DBGET integrated database retrieval system