KEGG   Danio rerio (zebrafish): 553734Help
Entry
553734            CDS       T01004                                 

Gene name
scdb, zgc:112951
Definition
stearoyl-CoA desaturase b
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    553734 (scdb)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    553734 (scdb)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    553734 (scdb)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     553734 (scdb)
Lipid biosynthesis proteins [BR:dre01004]
 Desaturase
  First
   553734 (scdb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
13
AA seq 316 aa AA seqDB search
MADVTTTTEDVFDDSYVEKPGPSPPVQIVWRNVILMTLLHLGALYGMTILPFVSSLTLIW
TGVCFMVSALGITAGAHRLWSHRSYRASLPLRIFLAVANSMAFQNDIYEWARDHRVHHKF
SETDADPHNARRGFFFAHIGWLLVRKHPEVIDKGRKLTFEDLKADSVVMFQRRHYKLSVV
VMCFLIPTLVPWFFWEESLWTAYLVPCLLRYAVVLNATWLVNSAAHMWGMRPYDHNINPR
ENKFVAFSAIGEGFHNYHHTFPHDYATSEFGSRLNVTKAFIDLMCFLGLANDCRRVTHET
ILARVQRTGDGSHKSG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccgatgtgacgacgacgacagaggatgtttttgatgattcttatgtggagaaaccg
ggcccgagtcctccggtacaaatcgtatggagaaatgtcatattaatgactctattgcac
ctaggagcgctttatggaatgacgattcttccttttgtctcttccttaaccctcatatgg
acgggagtgtgtttcatggtaagtgctctaggaataactgccggcgcccatcgcctctgg
agccaccggtcctacagggcctcactgccattacggatcttcctagcagtcgcaaactct
atggcttttcagaatgatatctatgagtgggccagagatcaccgcgtccatcacaagttt
tctgagacggatgcagacccccacaacgctcgcagaggattcttctttgctcacatcggc
tggctactggtccgtaaacacccagaagtcattgataaaggacgcaagctgacgtttgaa
gatctaaaagcagacagtgttgtaatgtttcagaggaggcattacaagttatctgtggtg
gtgatgtgctttcttatcccaaccttggtaccttggtttttttgggaggagagtctttgg
actgcttacttggtgccatgtctgctgagatacgctgtggtccttaatgcaacctggctg
gtcaacagcgccgctcacatgtggggaatgagaccctacgaccacaacatcaatcccaga
gagaacaagtttgtcgccttcagtgccatcggtgaaggattccacaactatcatcacaca
ttcccccatgattatgccacaagtgagttcggcagtcggctgaacgtgaccaaagcgttc
atcgatctcatgtgcttcctgggactggccaacgattgcagaagggtaactcacgaaacc
atcctcgcccgtgttcagcgcacaggtgacggcagccacaaaagtggttga

DBGET integrated database retrieval system