KEGG   Danio rerio (zebrafish): 553758Help
Entry
553758            CDS       T01004                                 

Gene name
usp7, fc48f04, wu:fc48f04
Definition
ubiquitin specific peptidase 7 (herpes virus-associated)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
dre  Danio rerio (zebrafish)
Pathway
FoxO signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    553758 (usp7)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    553758 (usp7)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     553758 (usp7)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   553758 (usp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
3
AA seq 1110 aa AA seqDB search
MNHHHTQQQQQKAGEQQLSEPEDMEMEAGDPDDPPRIPQNPVINGNVAMADGHNNTEEDM
EDDTSWRSEATFPFVVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAMLKIINYKDDEKSFSRRISHLFFHKENDWGFSNFMSWSDVTDP
ERGFVEDDKVTFEVYVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
RAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKN
IFESFKDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKPDVKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKVSV
TAPIWCKFDDDVVSRCTKEEATEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPVT
DMDIPQQLVERLQEEKRVEAQKRKERQEAHLYMQVQMVTEDQFCGHQGNDMYDEEKVKYT
VFKVLKSSTLAEFVQNLSQTMGFPQDQMRLWPMQARSNGTKRPAMLDYEADCNKSMIDLS
DNENPWTIFLETVDPEMAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCK
IRDLLPVMCERAGFQQGTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDD
PENDTSELPTAKDYFRDLYHRVDVIFCDKTIHNDPGFVVTLSNRMNYFQVAKTVAQRLNT
DPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRR
SFKAIWLNSMFREEEITLYPDKHGCVRDLLEECKKAVELSDKGSEKLRLLEIVSYKIIGV
HQEDELLECLSPAASRTFRIEEIPLDQVDLDKENEMLIPVAHFHKEVFGTFGIPFLLKIR
QGEPFREVMKRIQSMLDIQEKEFEKFKFAIVMMGRHQYINEEDYEVNLKDFEPQPGNMSH
PRPWLGLDHFNKAPKRGRYTYLEKAIKIHN
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatcacacccagcagcagcagcagaaagccggcgagcagcagctcagcgag
cccgaggacatggagatggaggctggggacccagatgatcctccaagaatcccacagaat
ccagttatcaatgggaacgtggctatggcggacggacacaacaacacagaggaggacatg
gaggatgacacaagctggcgttctgaagccactttcccctttgtggtggagcgctttagc
aggctgagtgagtctgtgctcagcccaccctgtttcgtgagaaatctgccctggaagatc
atggtgatgcccaggttttatccagacagacctcaccagaagagcgtcggattcttcctt
cagtgcaatgctgagtcagactccacgtcctggtcatgtcatgctcaagccatgcttaaa
ataatcaactacaaagacgatgagaagtccttcagtcgccgaataagtcacctattcttc
cacaaggaaaatgactggggcttttccaacttcatgtcatggagtgatgtgactgatccg
gaacggggctttgtagaggatgataaggtcacttttgaggtctatgttcaagccgatgca
cctcatggtgtggcctgggattcaaagaaacacactggttatgtggggttgaagaatcaa
ggagccacatgttacatgaacagcttactgcagactctcttctttacaaaccagcttcgg
cgggcggtttatatgatgcccactgagggagatgattcctctaaaagtgtccccctcgcc
ctgcagagggtgttctatgagctccagcacagtgataagcctgttgggacaaagaagctg
accaagtcttttggatgggaaactttagacagtttcatgcagcatgatgtacaggaacta
tgcagagtgctgttggacaatgtggagaacaagatgaaaggaacttgcgtggagggcaca
atcccaaagcttttccgagggaagatggtgtcttacattcagtgtaagcatgtggactat
cggtcagaaagaatagaggattactacgacatccagctcagcataaaaggaaagaaaaac
atctttgagtcattcaaggattatgtggctgtggaacagctggatggggacaacaaatat
gatgccggggagcatggtctgcaggaagcagagaagggtgtgaagttcttgaccttccct
cccatcttgcacctgcagcttatgaggttcatgtatgatcctcagactgaccaaaacatt
aagataaacgacaggtttgagttcccagagcagttacctctggatgagtttctgcagaaa
cctgacgtgaaagacccagccaactacattctccacgctgtgttggtacacagcggagac
aaccacgggggccactacgtcgtctaccttaatcctaaaggagacggcaaagtgagtgtc
actgcaccaatatggtgtaaatttgacgatgatgtcgtttcacggtgcactaaagaagag
gccactgaacacaattacggtggtcacgatgacgacttgtcagtgcgtcactgcaccaac
gcttacatgttggtgtatatccgagagtccaagctcagtgaggtcctgcagccggtcaca
gacatggacatcccgcagcagctagtggagaggctgcaggaggagaagagggtggaggct
cagaagaggaaagagaggcaggaggctcacctttacatgcaagtacagatggtgacagaa
gaccagttctgtggacatcagggcaatgacatgtatgatgaggaaaaagtcaaatacaca
gtgttcaaggttctaaagagctccacgctggctgagtttgtccagaacctctcgcagacc
atgggtttcccacaggaccagatgagactctggccaatgcaggccagaagcaatggcact
aaacggccggccatgttggattatgaagccgattgcaacaagtctatgatcgacttgagt
gataacgagaacccatggacaatatttctggaaactgtagatccagaaatggccgccagt
ggtgcaacgttacccaaatttgacaaagaccatgacgttatgttgttcttgaaaatgtat
gatccaaaaaccagaagcttaaattattgtggacatatctacacacctatatcctgtaaa
atacgagacttgctgcccgttatgtgtgaaagagcagggtttcagcagggaactagcctt
atcctctatgaggaagttaaaccgaatttaacagagagaatacaagactatgatgtctcc
ctggacaaagctctggacgagctgatggatggagacataattgtgttccagaaggatgat
cctgaaaatgacaccagtgagctgcctactgcgaaagactacttcagagacctgtaccac
cgtgtggatgtcatcttctgtgacaagaccattcacaacgacccgggatttgttgtcacg
ctgtcaaaccgaatgaactactttcaggtggcaaagactgttgcacagaggttaaatact
gacccaatgctcctacagttcttcaagtcacaggggtacagagacggcccaggcaaccct
ctcaggcacaactatgaaggcactctcagagacctgctgcagtttttcaagccccggcag
cctaagaagctgtactaccagcagctcaagatgaagatcacagactttgagaacaggagg
agtttcaaagccatatggctcaacagtatgtttcgagaggaggagatcacactatatcct
gacaagcatggctgtgttcgggacctactggaggaatgtaaaaaagcagtggagctctct
gacaaaggctcggagaagctaaggctgttagaaattgtcagctacaaaattattggggtt
caccaggaagacgaattgctagaatgtttatctccagcagccagtcgaacattcagaata
gaggaaattcctctggaccaggtagatctggacaaggagaacgaaatgctgattccagtt
gcacatttccataaggaagtcttcgggacattcggaattccttttttgcttaagattcgt
cagggggaacccttcagagaagtgatgaagagaattcagagcatgcttgacattcaggag
aaagaatttgagaagttcaagtttgcaatagtgatgatgggccggcatcagtatatcaat
gaggaagattacgaggtgaatctgaaagactttgagccacagccagggaacatgtcgcac
ccgaggccttggttagggctcgaccacttcaacaaagctccaaagagaggtcgctacacg
tatctggaaaaagcgatcaagattcacaactga

DBGET integrated database retrieval system