KEGG   Danio rerio (zebrafish): 553780Help
Entry
553780            CDS       T01004                                 

Gene name
mapk15, erk7, zgc:110345
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 524 aa AA seqDB search
MNITEVEEHISSKYEIKRRLGKGAYGIVWKAVDRKSGETVAVKKIFDAFRNRTDAQRTFR
EIMFLQEFGDHPNIIKLLNVIRAQNDKDIYLIFEFMDTDLHAVIKKGNLLKDIHKRYVMY
QLLKATKYLHSGNVIHRDQKPSNILLDSDCFVKLCDFGLARSLYQIQEDAGNPALTEYVA
TRWYRAPEILLGSSRYTKGVDMWSIGCILAEMLLGKPLFPGTSTINQIEKIMNVIPHPST
EDVLAIRSEYGASVIQRMLLRPQVPLDEILPASVPPDALDLLQRLLLFNPDKRLSAEEAL
RHPYVSKFHNPSSEPSLLYDVILPVDDDVQLSVTQYRNKLYEMIVEKRASRQMQKQPHIR
QKLEEKPAEVHVDGGLTRSSEADGSVKPPSHLLRLVKRNQESAGVLPAEGANGPVAADPR
GRSAPVARTHSFSLTLAQPLNNPLIRKDEAIVSPGLCVTSACLNHRPVSNSRDAKIPPRF
SKKVFQSQANVSAAGDPRAKLGSYSQAYGTISKTGLDSLMRNCN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcacagaagtggaagaacacatcagctcgaagtatgaaatcaagagaaggctg
gggaaaggggcatatggaattgtctggaaggctgtggacagaaaaagtggagagactgtc
gctgtgaagaaaatctttgatgcatttaggaacagaacagacgctcagagaacattcaga
gaaattatgttcctccaggagtttggagatcatcctaatataataaaattactaaacgtc
atcagagcccaaaacgacaaagatatttaccttatatttgaattcatggatacagaccta
catgcagtgataaagaaaggaaatctattaaaagacattcataagcgttatgtaatgtac
caacttcttaaagcaacaaaatatcttcattcaggcaatgtcattcacagagaccaaaag
ccatccaacatcttattagactcagattgcttcgtgaagctgtgtgatttcggtttggcg
agatctctgtaccaaatccaagaggatgctgggaatcctgcattaacagagtatgttgca
acacgatggtatcgagctcctgaaatacttctgggatcctcaaggtacacaaaaggtgtg
gacatgtggagtataggatgcatcctggcggagatgctgctgggcaaaccgcttttccct
gggacgtctaccattaatcaaatagaaaaaatcatgaacgtcattccacatccttcgaca
gaggatgtgttggccatcagatcagagtacggggcgtctgtgattcagagaatgctgctt
agaccgcaggtgccattagatgagattctgccggcctcagtgccacctgatgcccttgat
ttactgcaacgcctgctgcttttcaatccagacaagagactcagcgcggaagaagctctg
cggcatccgtatgtgtccaaatttcacaacccatccagcgagcccagtttgctctatgac
gtcattttgcccgtggatgatgacgtccagctctccgttacacaatacagaaacaaactc
tatgagatgatcgtggagaaaagggccagtcgacaaatgcagaagcagcctcatatcagg
cagaagctggaggagaagcctgcggaggtgcatgtggacggtggattaaccagaagcagt
gaagcagatggttcagtcaaacctccgtctcatcttctgagattagtgaagaggaatcag
gagagcgctggtgtcctgcctgcagagggtgctaacgggcctgtggctgcagacccacgc
ggtcgatcggctcctgttgctcgcacacactctttctctctcacactcgcgcagccactg
aataatcccctgatccgcaaggatgaagccattgtttcccccgggctgtgtgtcacctct
gcgtgcttgaaccacaggcctgtttctaattccagagatgccaagattcctccgcggttc
agcaagaaggttttccagagtcaagccaatgtttctgcagccggagatccaagagccaaa
ctgggcagctactctcaggcctacgggaccatcagcaagaccgggctggacagtctgatg
aggaactgcaactga

DBGET integrated database retrieval system