KEGG   Danio rerio (zebrafish): 553780Help
Entry
553780            CDS       T01004                                 

Gene name
mapk15, erk7, zgc:110345
Definition
(RefSeq) mitogen-activated protein kinase 15 (EC:2.7.11.24)
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     553780 (mapk15)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   553780 (mapk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
19
AA seq 523 aa AA seqDB search
MNITEVEEHISSKYEIKRRLGKGAYGIVWKAVDRKSGETVAVKKIFDAFRNRTDAQRTFR
EIMFLQEFGDHPNIIKLLNVIRAQNDKDIYLIFEFMDTDLHAVIKKGNLLKDIHKRYVMY
QLLKATKYLHSGNVIHRDQKPSNILLDSDCFVKLCDFGLARSLYQIQEDAGNPALTEYVA
TRWYRAPEILLGSSRYTKGVDMWSIGCILAEMLLGKPLFPGTSTINQIEKIMNVIPHPST
EDVLAIRSEYGASVIQRMLLRPQVPLDEILPASVPPDALDLLQRLLLFNPDKRLSAEEAL
RHPYVSKFHNPSSEPSLLYDVILPVDDDVQLSVTQYRNKLYEMIVEKRASRQMQKQPHIR
QKLEEKPAEVHVDGGLTRSSEADGSVKPPSHLRLVKRNQESAGVLPAEGANGPVAADPRG
RSAPVGRTHSFSLTLAQPLNNPLIRKDEAIVSPGLCVTSACLNHRPVSNSRDAKIPPRFS
KKVFQSQANVSAAGDPRAKLGSYSQAYGTISKTGLDSLMRNCN
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcacagaagtggaagaacacattagctcgaagtatgaaatcaagagaaggctg
gggaaaggggcgtatggaattgtctggaaggccgtggacagaaaaagtggagagactgtc
gctgtgaagaaaatctttgatgcctttaggaacagaacagacgctcagagaacattcaga
gaaattatgttcctccaggagtttggagatcatcctaatataataaaattactaaacgtc
atcagagcccaaaacgacaaagatatttaccttatatttgaattcatggacacagaccta
catgcagtgataaagaaaggaaatctattaaaagacattcataagcgttatgtaatgtac
caacttcttaaagcaacaaaatatcttcattcaggcaatgtcattcacagagaccaaaag
ccatccaacatcttattagactcagattgcttcgtgaagctgtgtgatttcggtttagcg
aggtctctgtaccaaatccaagaggatgctgggaatcctgcattaacagagtatgttgca
acacgatggtatcgagctcctgaaatacttctgggatcctcaaggtacacaaaaggtgtg
gacatgtggagtataggatgcatcctggcagagatgctgctgggcaaaccactgttccct
gggacgtctaccattaatcaaatagaaaaaatcatgaacgtcattccacatccttcgaca
gaggatgtgttggccatcagatcagagtacggggcgtctgtgattcagagaatgctgctt
agaccgcaggtgccattagatgagattctgccggcctcagtgccacctgatgcccttgat
ttactgcaacgcctgctgcttttcaatccagacaagagactcagcgcggaagaagctctg
cggcatccgtatgtgtccaaatttcacaacccatccagcgagcccagtttgctctatgac
gtcattttgcccgtggatgatgacgtccagctctccgttacacaatacagaaacaaactc
tatgagatgatcgtggagaaaagggccagtcgacaaatgcagaagcagcctcatatcagg
cagaagctggaggagaagcctgcggaggtgcatgtggacggtggattaaccagaagcagt
gaagcagatggttcagtcaaacctccgtctcatctgagattagtgaagaggaatcaggag
agcgctggtgttctgcctgcagagggtgctaacgggcctgtggctgcagacccacgcggt
cgatcggctcctgttggtcgcacacactctttctctctcacactcgcgcagccactgaat
aatcccctgatccgcaaggatgaagccattgtttcccccgggctgtgtgtcacctctgca
tgcttgaaccacaggcctgtttctaattcccgagatgccaagattcctccgcggttcagc
aagaaggttttccagagtcaagccaatgtttctgcagccggagatccaagagccaaactg
ggcagctactctcaggcctacgggaccatcagcaagaccgggctggacagtctgatgagg
aactgcaactga

DBGET integrated database retrieval system