KEGG   Danio rerio (zebrafish): 553969Help
Entry
553969            CDS       T01004                                 

Gene name
cyp3a65, zgc:123110
Definition
cytochrome P450, family 3, subfamily A, polypeptide 65
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:dre00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:dre00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dre00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
1
AA seq 517 aa AA seqDB search
MFFSAETWTLLAFLAALLVIYGSWPHRYFKKLGIPGPKAIPFFGTMLRYKDGFHVFDMDC
FEKYGRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRNFRLNGALYDAVSIAEDD
DWRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTAKRGESADIKEFFGAYSMDVV
TSTAFSVDIDSLNNPKDPFVTNIKKMLKFDLLNPLFLLIAFFPFMAPVLEKMDFALFPTS
VTDFFYAALQKIKSDRDTKTVAKDNTKKRVDFLQLMVDSQTGVKHKSDGEHTEKGLSDHE
ILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEIDETFPNQAPVDYETLMSMD
YLDAALSESLRLFPVAARLERVCKKTVEINGLLIPKDLVVMVPTYALHRDPDYWSEPESF
KPERFTKGNKESIDPYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVP
LELGFNGLLSPKDPIKLKLQPRKLSQSPDVCNNNQKS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcggcagaaacatggactctgctggcgttcttggcggcgctgctggtcata
tatggatcctggcctcataggtacttcaagaagctgggcatcccggggcccaaagccatc
ccattcttcggcaccatgctgagatacaaggatggctttcatgtcttcgatatggattgt
tttgagaagtatggacggatctggggtatctatgacgggaggcagcctgttctgtgcatc
atggaccaaaccatcatcaaaaccgttctgatcaaagagtgttactccctcttcaccaac
agaaggaacttccgtctgaacggggcgctgtacgatgccgtgtccatcgcagaagatgac
gactggaggaggatccgcagcgtcctctcgccatctttcaccagcggaaggctgaaggag
atgtttggcatcatgaagaaacacagtcacattctggttgacagcatggggaaaacagca
aagagaggagagtctgcggatattaaagagttcttcggtgcgtacagtatggatgtggtg
accagcactgcgttcagcgtcgacatcgactccctcaacaaccccaaagacccatttgtg
accaacatcaagaaaatgctgaagtttgacctgctgaaccctctcttcctgttgatcgct
tttttccccttcatggcccccgtcctggagaagatggatttcgcccttttccccacatct
gtgaccgatttcttctacgccgccttacagaagatcaagtccgacagagacacgaagaca
gtggccaaagacaacacgaagaagagagtggacttcctgcagctgatggttgattctcag
actggagtgaaacacaaaagtgatggagagcacacggagaaaggtctgagtgaccacgag
atcttatcgcagtccatgatcttcatcttcgccggttacgagaccagcagcagcactctg
tccttcctcttctacaatctggcaaccaacccagagaccatgaagaaactgcaggaggag
atcgacgagaccttccccaaccaggccccggtggactatgaaaccctgatgagcatggac
tacctggacgcagcgctgtccgagtctctgcggctgttccccgtcgctgcacgccttgag
cgcgtctgcaagaagacagtggagatcaacggcctcctcatccccaaagacttggtggtc
atggtgccgacctacgccctccacagagaccccgattactggagcgaaccggagagcttc
aaacccgagaggttcactaaaggcaataaagagtcgatagacccctacatgtacatgccg
ttcggtctgggccccaggaactgcatcggcatgcgtttcgctcaggtgaccatgaagctg
gccatcgtggagatcctgcagaggttcgacgtctctgtgtgtgacgagacacaggttcct
ctggagctgggcttcaatggcctactgtccccgaaagaccccatcaagctgaagctccag
ccccgcaagctctcgcagtcgccggacgtgtgcaacaacaaccagaaatcatga

DBGET integrated database retrieval system