KEGG   Danio rerio (zebrafish): 553969Help
Entry
553969            CDS       T01004                                 

Gene name
cyp3a65, zgc:123110
Definition
cytochrome P450, family 3, subfamily A, polypeptide 65
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    553969 (cyp3a65)
   00591 Linoleic acid metabolism
    553969 (cyp3a65)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    553969 (cyp3a65)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     553969 (cyp3a65)
Cytochrome P450 [BR:dre00199]
 Cytochrome P450, animal type
  CYP3 family
   553969 (cyp3a65)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
1
AA seq 517 aa AA seqDB search
MFFSAETWTLLAFLAALLVIYGSWPHRYFKKLGIPGPKAIPFFGTMLRYKDGFHVFDMDC
FEKYGRIWGIYDGRQPVLCIMDQTIIKTVLIKECYSLFTNRRNFRLNGALYDAVSIAEDD
DWRRIRSVLSPSFTSGRLKEMFGIMKKHSHILVDSMGKTAKRGESADIKEFFGAYSMDVV
TSTAFSVDIDSLNNPKDPFVTNIKKMLKFDLLNPLFLLIAFFPFMAPVLEKMDFALFPTS
VTDFFYAALQKIKSDRDTKTVAKDNTKKRVDFLQLMVDSQTGVKHKSDGEHTEKGLSDHE
ILSQSMIFIFAGYETSSSTLSFLFYNLATNPETMKKLQEEIDETFPNQAPVDYETLMSMD
YLDAALSESLRLFPVAARLERVCKKTVEINGLLIPKDLVVMVPTYALHRDPDYWSEPESF
KPERFTKGNKESIDPYMYMPFGLGPRNCIGMRFAQVTMKLAIVEILQRFDVSVCDETQVP
LELGFNGLLSPKDPIKLKLQPRKLSQSPDVCNNNQKS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctcggcagaaacatggactctgctggcgttcttggcggcgctgctggtcata
tatggatcctggcctcataggtacttcaagaagctgggcatcccggggcccaaagccatc
ccattcttcggcaccatgctgagatacaaggatggctttcatgtcttcgatatggattgt
tttgagaagtatggacggatctggggtatctatgacgggaggcagcctgttctgtgcatc
atggaccaaaccatcatcaaaaccgttctgatcaaagagtgttactccctcttcaccaac
agaaggaacttccgtctgaacggggcgctgtacgatgccgtgtccatcgcagaagatgac
gactggaggaggatccgcagcgtcctctcgccatctttcaccagcggaaggctgaaggag
atgtttggcatcatgaagaaacacagtcacattctggttgacagcatggggaaaacagca
aagagaggagagtctgcggatattaaagagttcttcggtgcgtacagtatggatgtggtg
accagcactgcgttcagcgtcgacatcgactccctcaacaaccccaaagacccatttgtg
accaacatcaagaaaatgctgaagtttgacctgctgaaccctctcttcctgttgatcgct
tttttccccttcatggcccccgtcctggagaagatggatttcgcccttttccccacatct
gtgaccgatttcttctacgccgccttacagaagatcaagtccgacagagacacgaagaca
gtggccaaagacaacacgaagaagagagtggacttcctgcagctgatggttgattctcag
actggagtgaaacacaaaagtgatggagagcacacggagaaaggtctgagtgaccacgag
atcttatcgcagtccatgatcttcatcttcgccggttacgagaccagcagcagcactctg
tccttcctcttctacaatctggcaaccaacccagagaccatgaagaaactgcaggaggag
atcgacgagaccttccccaaccaggccccggtggactatgaaaccctgatgagcatggac
tacctggacgcagcgctgtccgagtctctgcggctgttccccgtcgctgcacgccttgag
cgcgtctgcaagaagacagtggagatcaacggcctcctcatccccaaagacttggtggtc
atggtgccgacctacgccctccacagagaccccgattactggagcgaaccggagagcttc
aaacccgagaggttcactaaaggcaataaagagtcgatagacccctacatgtacatgccg
ttcggtctgggccccaggaactgcatcggcatgcgtttcgctcaggtgaccatgaagctg
gccatcgtggagatcctgcagaggttcgacgtctctgtgtgtgacgagacacaggttcct
ctggagctgggcttcaatggcctactgtccccgaaagaccccatcaagctgaagctccag
ccccgcaagctctcgcagtcgccggacgtgtgcaacaacaaccagaaatcatga

DBGET integrated database retrieval system