KEGG   Danio rerio (zebrafish): 554097Help
Entry
554097            CDS       T01004                                 

Gene name
zgc:112234
Definition
(RefSeq) uncharacterized protein LOC554097
  KO
K11252  histone H2B
Organism
dre  Danio rerio (zebrafish)
Brite
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    554097 (zgc:112234)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   554097 (zgc:112234)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like
Motif
Other DBs
NCBI-GeneID: 554097
NCBI-ProteinID: NP_001019569
ZFIN: ZDB-GENE-050522-106
UniProt: Q05AK8
Position
7
AA seq 124 aa AA seqDB search
MPEPAKTAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccagctaagactgcacccaagaagggttccaagaaggcggtaactaaaacc
gccggcaaaggaggaaagaagcgtaagaggacaaggaaggagagctatgccatctacgtg
tacaaggtgctgaagcaggtccatcctgatactggaatctcctctaaagcgatgggcatc
atgaactcgttcgtcaacgatatcttcgagcgcatcgccggtgaggcttcccgtctcgct
cattacaacaagcgctctaccatcacatctagggagatccagaccgccgtgcgtctgctg
ctgcccggggagttggccaaacacgccgtgtctgagggcactaaggccgtcaccaagtac
accagctccaagtaa

DBGET integrated database retrieval system