KEGG   Danio rerio (zebrafish): 554104Help
Entry
554104            CDS       T01004                                 

Gene name
uchl3, im:6908825, zgc:109963
Definition
ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) (EC:3.4.19.12)
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
9
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVMNQFLRQLGLVPTWQFGDVYGLELEVLSLVPRPVCAVLLLFPITE
KYETFRQEEEAKIKGQGQEVSSDVYFMKQTIGNACGTIGLIHAVANNQNHLEFELNSPLK
TFLLQSAKMSPEEKAAFLEKDESIRVTHESSAQEGQTEAPGLDEKVDLHFIAFVNVDGHL
YELDGRKPFPIVHGKTTEDTFLEDSAEVCKKFMARDPQELRFTVVALSKA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggccagcgctggttaccactggaagcaaacccagaggttatgaaccaattttta
cggcagcttggcttggtacccacctggcagtttggagatgtgtacggcttggagcttgaa
gttctcagtttggtgccaaggcctgtgtgcgctgtacttttgctcttccctataacagag
aagtatgaaacctttagacaggaggaagaggcaaaaattaaaggacaaggacaagaggtg
tcctcagatgtgtactttatgaaacaaaccatcggcaatgcttgtggaacaatagggctc
attcatgctgtggcaaacaatcaaaatcatctagagtttgagctcaattcaccacttaag
acatttttactccagtctgcaaagatgagtccagaagaaaaggcagctttccttgaaaaa
gatgagagtattcgagtaacacatgaatcaagtgctcaggagggacaaacagaggctcca
ggtttagatgaaaaagtggatttgcattttattgccttcgtaaatgttgacgggcattta
tatgaactggatggtcgcaaaccttttccaattgttcatggaaagaccacagaggacaca
tttcttgaggattctgcagaggtctgcaagaagttcatggcccgtgatcctcaggagctt
cgcttcactgtggtggctctttctaaagcataa

DBGET integrated database retrieval system