KEGG   Danio rerio (zebrafish): 554736Help
Entry
554736            CDS       T01004                                 

Definition
uncharacterized LOC554736
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dre  Danio rerio (zebrafish)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    554736
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     554736
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     554736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17
AA seq 181 aa AA seqDB search
MSVFEAWYMDEESGEDQRLPHKLSPNQPVSVQQLEHIGVFHWKLNADIYENDPELQKIRE
EKGYSFMDIITIHPDKLPDYQNKLKMFYEEHLHLDDEIRYILEGSSYFDVRDEGDRWIRI
AVSKGDLITLPAGIYHRFTVDESNYTKAMRLFVGEPVWKAYNRPADDFDIRKEYVNSLGS
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttcgaggcatggtacatggatgaagagtccggagaggaccagagactcccg
cacaaactgagcccgaatcagcccgtcagcgtccagcagctggagcacatcggagtcttt
cactggaagctgaacgctgatatctatgaaaatgaccccgaactgcagaagatccgagag
gagaagggttattcctttatggacatcataaccattcacccggacaaactgcccgattac
caaaacaaactgaaaatgttttacgaagagcatctccacctggacgatgagatccgttat
attctggaaggatcctcttattttgatgtgcgggacgaaggcgaccgctggatccgaata
gcggtgtctaaaggcgacctcatcactttaccggccgggatttaccacagattcaccgtg
gacgaaagcaactacactaaagccatgcgtctgttcgtgggtgaacccgtctggaaggcc
tacaaccgtccagccgatgactttgacatccgcaaggaatacgtgaactcgctgggaagc
tcctga

DBGET integrated database retrieval system