KEGG   Danio rerio (zebrafish): 555344Help
Entry
555344            CDS       T01004                                 

Definition
novel protein similar to vertebrate core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 (C1GALT1)
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
dre  Danio rerio (zebrafish)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    555344
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     555344
Glycosyltransferases [BR:dre01003]
 Glycan extension
  Type 3 chain
   555344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
19
AA seq 247 aa AA seqDB search
MTQPQNLQSRTQHVHATWGKRCDTILYMTSKNTDFPTIGLNVSEGRNQLYWKTIRAFQYI
HKHHLDDADWFLKADDDTFVVIENLRHSLSKHSSEDPLYFGRRFRPFVAQGYMSGGAGYV
LSKEALRRFVKGFADGLCTHTTELEDVGMGQCMEKMKVEMGDSRDVFGRQVFHPYPPGNY
LVRQLRRQRPWYLIYDHYTPVEGPGCCSDFAISFHYINAVEMHTLEYYTYHLRPYGYKYR
FNPDELK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctcaaaacctgcagtccagaacccaacacgttcatgccacatggggcaaa
cgctgcgacaccatcttgtacatgacctcgaagaacacggacttccccacgatagggctc
aatgtgtcagaaggacgcaatcaactctactggaagaccatacgagccttccagtacatt
cacaagcaccatttggatgatgctgattggttcctcaaagctgacgatgacacatttgtt
gtcattgagaatttgcgccatagcttgtccaaacacagctcagaggatcctctgtatttt
ggacgtcgcttcaggccctttgttgcacaaggctacatgagtggaggggccggttacgtc
ctcagtaaagaagctttgagaagatttgtgaaggggtttgctgatggactttgtacgcac
accacagaacttgaggatgttggaatgggacaatgcatggagaaaatgaaagttgagatg
ggggattccagggatgtgtttgggagacaagtctttcacccttaccctccaggcaattac
ttggtgagacagctacgcagacaacgaccctggtacctcatctatgatcattatactcca
gttgagggtccgggatgctgctcagattttgccatctcattccattacataaacgcagtg
gaaatgcacacattggagtactacacatatcatttacgcccgtatggatacaaatacaga
ttcaatccagatgaactgaaatga

DBGET integrated database retrieval system