KEGG   Danio rerio (zebrafish): 555443Help
Entry
555443            CDS       T01004                                 

Gene name
plcd1a, zgc:165641
Definition
(RefSeq) phospholipase C, delta 1a (EC:3.1.4.11)
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    555443 (plcd1a)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    555443 (plcd1a)
   04070 Phosphatidylinositol signaling system
    555443 (plcd1a)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    555443 (plcd1a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     555443 (plcd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
24
AA seq 775 aa AA seqDB search
MSCPFKPLKRTKSEEFIYQEKSKNVSKENGKRIGLDEDPDLQFLLRGGDLIKVKSNSWKK
TRFLKLNEDCKTIYQSSSKAFKRESSFELAEIDSVRLGRQSEGLQKYTYSSIENRCFSII
FKGRRENLDLIASSDDEANCWVNSLEKVINRLHKLNRQQNSEHWIYECMRKADKNADNKM
SLKELKHFLRQINIEVNDSYAETLFRKCDTSNSGTLEGSEIKLFYNLLTQRDEIDVIYDK
YATSNGQMSRNDLLNFIQLEQREPVSLGYAEELIKKYEVDETAKQDKHMSKDGFLMYLNQ
EGTLLNPAHIDVYQDMQQPLNHYFISSSHNTYLMEDQLKGPSSTEAYIKALMKSCRCVEL
DIWDGANGEPVIYYGHTLTSKVPFKDVIKAIKDYAFKASPYPVILSLENHCSLEQQKIVA
MHLTTILGSALLTQPLGQKMPTTFPGPEDLKGRFLIKGKRLNKLDAAFNNNTAEDVESVS
EEDEAADLKEGEPTHKDSKKSKKIKLAKELSDLVVYCKSVHFTSFEQSRKKQAFYEMASF
KEGKAMNLAEQSANAFIRHNIDKLSRIYPAGSRTDSSNYNPVPLWNAGCQIVALNFLTPC
KEMDLNQARFLPNGKSGYILKPEFLRDPASQFDPINLRKGPWLQKKVLHIMVISAQQLPK
INKNKEKSIVDPHVRVEIYGVPQDNASKQTHHIDNNGFNPMWNTNFQFTVNVPELALVRF
VVEDYDAASKNDLIGLYTIPLTSMQNGYRHMPLLTKRGIIIPSAGLFVHVMLLDA
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtccatttaaacctctcaaaaggacgaaatcagaggaattcatttatcaggag
aagtccaagaacgtgtcaaaagagaatggcaagcgcataggtttggatgaagacccagac
ttacagtttttgctcagaggtggagacctgataaaagtgaagtccaactcgtggaagaag
acccgctttttgaaactgaatgaagactgcaagactatttatcagtcgtccagcaaggca
ttcaagagagaatccagctttgaacttgcggaaattgattctgtgcgtctcggccgacag
tctgaaggactgcagaaatacacatattcctcgattgagaatcgctgcttctccatcatc
ttcaaaggtagacgggaaaacctggacctgatcgcctcttctgatgatgaagccaattgt
tgggtcaacagcctggagaaggttatcaaccgcctgcataaactcaatcgccaacagaac
agtgaacactggatctatgaatgcatgcgcaaggcagacaagaatgcagacaacaaaatg
tccttgaaggagttgaagcatttcctgcgccaaatcaatattgaggtgaacgacagttac
gcagagacactcttcaggaagtgtgacacatccaattctggcaccctagagggatccgag
attaaactcttctacaatttgctgactcaacgtgatgaaattgatgtgatctatgacaaa
tatgctacaagtaatggccagatgagccgcaatgacctgttgaacttcatccaacttgaa
cagagggagccagtgtctttgggctatgcagaagaacttattaaaaaatatgaggtggat
gagacagcaaaacaagacaagcatatgagcaaagatggtttcctgatgtacctgaaccaa
gaaggcaccctgctaaatccggcccacattgacgtgtaccaagatatgcagcagccattg
aatcattacttcatttcatcttcccataacacttatctgatggaggaccagctgaagggg
cccagcagcacagaagcctatatcaaagcgctgatgaagagctgtcgctgtgtggagctg
gatatctgggatggagcaaatggggagccagtcatttactatggccacacactcacatcc
aaagtgccgtttaaagacgtcattaaggctatcaaagattatgcttttaaagcctcaccg
tatccagtgatcttgtctttggagaaccattgttctttagagcagcagaaaatcgtcgcc
atgcacttaaccaccatcctgggcagtgctttgcttactcaaccgctgggacaaaaaatg
cccaccacatttccaggacctgaggacctgaagggacgtttcttgatcaagggaaagcgt
ttgaacaaacttgatgctgctttcaacaacaacactgcggaggatgtggagagtgtgtca
gaggaagacgaggctgccgatctgaaagagggtgaacccacacacaaagattcgaagaaa
tccaaaaagatcaagctggccaaggagctgtcagacctggttgtctactgcaagagtgtg
catttcaccagcttcgagcaatcaaggaaaaaacaggccttctatgagatggcttccttc
aaggagggcaaagccatgaacttagctgaacaatcagctaacgcattcattcgtcacaac
attgataagctgagcagaatctacccggctggatccagaacagattcatcaaactacaat
cctgtgccactgtggaacgctggatgccaaatagtggctctaaactttctgactccttgc
aaagagatggatctgaaccaggcccgatttcttcctaatggcaagtccggctacatactg
aagcctgagtttctgagagacccggcctcacagtttgaccccatcaacctcagaaaaggg
ccctggctgcagaagaaggtcctgcacatcatggtcatttcagcccagcagctcccgaag
atcaacaagaacaaggagaagtccattgtagatcctcatgtccgggtggagatttacggt
gttccacaggacaacgccagcaaacagacacatcacattgacaacaatggctttaatcca
atgtggaatacaaacttccagttcacagttaatgtgccagaactggcattggtgcgattt
gtagtggaggattatgacgctgcttcaaaaaatgacctgattggcctgtacactataccc
cttacaagcatgcagaacggttatcgtcatatgcctctgctcacgaagagaggaatcatc
attccttcagcaggactctttgtacacgttatgcttctagatgcttaa

DBGET integrated database retrieval system