KEGG   Danio rerio (zebrafish): 555459Help
Entry
555459            CDS       T01004                                 

Gene name
otud5a
Definition
(RefSeq) OTU domain-containing protein 5-A
  KO
K12655  OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    555459 (otud5a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     555459 (otud5a)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C85
   555459 (otud5a)
Ubiquitin system [BR:dre04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    555459 (otud5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTU Peptidase_C65
Motif
Other DBs
NCBI-GeneID: 555459
NCBI-ProteinID: NP_001068578
ZFIN: ZDB-GENE-030616-61
Ensembl: ENSDARG00000059006
Vega: OTTDARG00000023614
UniProt: Q08BW0
Position
8
AA seq 560 aa AA seqDB search
MTILPKKKPNSSVGVSDHPDDPDRRTGSDPHQHQHQHSHGVRPGARPRASPPPWSYQAAP
PASREDRRTESSSRPQQASPPPVGAGSSGGPGDATGMACVSGNRAELSGGVGCGGGMGGC
CSGPGLSKRRRQATCSGGVAGGGTGPGAAGGGGGGGGGGGVGGPSPEQEEGAGYNSEDEY
ENASRLQSEDPATVEQQEHWFEKALQEKKGFVIKKMKEDGACLFRAVADQVYGDQDMHEV
VRKHCMDYLMKNADYFSNYVTEDFTTYINRKRKNNCHGNHIEMQAMAEMYNRPVEVYQSG
TEPINTFHGIHQNNDEPIRVSYHRNIHYNSVVNPNKATIGVGLGLPAFKPGFADQSLMKN
AIKTSEESWIEQQMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQPRKASAT
CSSATAAASSGLEEWNARSPRQRSSAPSPEIPDPAHSDTAAKPPSPAGALALSKPPSPCA
PGPSNQACVGPDRPTSSSLVSLYPALGYRAIMQEMSPTAFGLTDWEDDEILASVLAVSQQ
EYLDSMKKNAMHREPSPDSS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcctgccgaagaagaagccgaactcgtcggtcggtgtgtccgatcaccctgac
gaccccgaccgacggaccggctccgacccgcaccagcatcagcaccaacactcccacggg
gtccggccgggtgcgaggccccgcgcttccccgccaccctggtcctatcaagccgctccg
ccggcgtccagagaggacaggcgaactgaatccagctcccggccgcagcaggcctctcct
ccgccggtgggtgccgggtcctcgggtggccccggggacgcgacagggatggcgtgcgtg
tcaggcaatcgggctgagctgtcaggtggggtgggctgtggaggtggcatgggaggttgc
tgttcggggcctgggctcagtaagagaagacgacaagcgacttgctccggtggggtggcc
ggtggaggcaccggacccggggctgcggggggtggaggcggcggtggtggaggaggtgga
gtagggggtcccagtcccgagcaggaggaaggagccgggtataacagtgaggatgagtat
gagaatgcttccagactacagtcagaggacccagcgactgttgaacagcaggaacactgg
tttgaaaaagcactccaggaaaagaaaggatttgtcatcaaaaaaatgaaggaagatggt
gcctgcctcttcagagctgttgctgatcaagtttacggagaccaggatatgcacgaagtc
gttcgcaagcactgcatggattacttgatgaaaaatgcagattacttctcaaactatgtg
acagaggacttcactacatacatcaacagaaagaggaagaacaactgtcatggcaaccac
attgagatgcaggcaatggcagagatgtacaatcggccagttgaagtttatcagtccggc
acagaaccaatcaacacgttccatggcatccatcaaaataatgacgagccaatcagagtt
agttaccatcgaaacattcactataactctgtagtgaatcccaacaaagccactattgga
gttgggctcggacttcctgccttcaaacccgggttcgcagatcagtcactcatgaagaat
gccatcaaaacgtcagaggaatcctggattgagcaacagatgctggaggacaagaagagg
gctacagattgggaagccaccaatgaggctatagaagagcaagtggccagagaatcgtat
ttacagtggcttcgagatcaggagaaacaggcacgacagcctcgtaaggccagtgctacg
tgcagctctgccacggctgcggcctccagtggtttggaagaatggaatgctcgatctcca
cggcaacgaagctccgccccttctccagagattcctgatcccgcacactcggacacagcg
gccaaacccccgtcccccgccggagccctcgctctgtccaaacctccgtcgccctgcgca
ccaggtcccagtaaccaggcttgcgttggaccagacagacccacctcgtcttctctggtg
tctctgtatccagcactcggttatcgggccattatgcaagagatgtcccctactgcattt
ggcctcacagactgggaagacgatgagatactggcgtcggtcttggccgtgtcacaacag
gaatacctcgatagcatgaagaaaaacgccatgcatagagaaccttctccagacagcagt
tga

DBGET integrated database retrieval system