KEGG   Danio rerio (zebrafish): 555517Help
Entry
555517            CDS       T01004                                 

Gene name
kat2a, gb:dq017634, im:7156024
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:dre04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Position
3
AA seq 795 aa AA seqDB search
MADPAAQSSAQPRLQQAQSSGPTGSNSNPGAGSSDPARPGLSQQQWSSQKKAQVRSFPRA
KKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSH
LENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMGKPVVEGS
LGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRA
QKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVE
KDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSPVSI
SGSPHSKGSSASALGVTGLDVASSEPTIGEKRKLPEALTLEDAKRIRVMGDIPMELVNEV
MKTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYI
KDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPGLTCFKEGVRQ
IPVESIPGIRETGWKPSAKEKSKELKDPDLLYNMLKNLLAQIKTHPDAWPFMEPVKKSEA
PDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKSANTLE
KFFYFKLKEAGLIDK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggcggcacagagctccgcgcagccccggcttcagcaagcgcagtccagc
ggcccgaccggctccaactcgaaccccggagccgggagcagcgacccggcccgaccgggc
ctaagccaacagcaatggtccagccagaagaaagcccaagtccgttcgtttccgcgggcg
aaaaagctggagaaactcggagtgttttcatcctgcaaggcgaatgatgcttgcaagtgc
aatggctggaaaaaccccaatccaccaacagcggctcgtatggagctccagcagcaggcc
gccagtctgacggagacctgccgaagctgtggacactctttggcggagcatgtgtcccac
ctggaaaacgtgtctgaggaggagattaaccggctgttggggatggtggtggatgtggag
aatctcttcatgtctgtccataaagaagaagacacggacaccaagcaagtctacttttat
ttgtttaagctgctgaggaagtgtattctgcagatggggaaaccagtggtggagggctct
ctcggtagccctcctttcgaaaaacccaacatagagcagggggtgttgaactttgttcag
tataagttcagtcatttggctcctaaagagaggcagaccatgtatgagctcagtaagatg
tttctcctctgtctgaactactggaagctggagacaccgtcacagtttcggcagagggct
cagaaagaggacgcagcggcatacaaagtcgattatactaggtggctgtgttactgtcac
gttcctcagagcaatgacagcttgccacggtatgagacctgtcaggtgttcggccgcagt
ttgctgaagtccatcttcactgtcacccgcagacagttactggagaagttcagagtggag
aaagacaaactgccgccagagaaacgcaccctcatcctcacacattttccaaagtttctt
tccatgttggaagaggaaatctatggagaaaactctcccatctgggaggcagacttcacc
atgccagcctcagagggcacacaactgggccatcaaacagtactgagtccagtgtccatc
tccggctctcctcacagtaagggcagcagcgcctctgctctgggtgttacaggtttggac
gtagcttcctctgaaccaacaatcggtgagaagcgaaagctgcctgaagcgctgactctg
gaggatgccaagcggatccgagtaatgggtgatattcccatggagctggtcaatgaagtt
atgaagaccatcacagaccctgctgccatgctgggccctgagaccagtctgctgtctgca
aacgcagctcgcgatgaaacggctcgtctggaggagaggagaggcatcattgagttccat
gtgatcggtaactcgctctctcagaagtcaaataagaagattctaatgtggctcgtgggc
ttgcaaaatgttttctcccatcagcttccccgcatgcccaaagagtacatcacgcgcctt
gtgtttgacccgaagcacaagacgttggctctgattaaagatggccgcgtgattggaggg
atctgctttaggatgtttcccactcagggattcacagagattgtcttttgtgctgtcacc
tccaatgaacaggtcaagggctacggcacacatctgatgaatcatcttaaagagtatcac
atcaagcacggaattctgtacttcctcacgtatgcggacgaatacgccatcggctacttc
aagaaacagggcttctccaaagacatcaaagtgccgaagagccgctacctcggctacatc
aaagactatgagggagccacgctgatggagtgcgagctcaatccccgaattccctacacc
gaactctcgcacatcatcaagaggcagaaagagatcattaagaaactgatcgagaggaaa
cagaatcagatcaggaaagtgtatcctggtctcacctgctttaaagagggtgtgcggcag
attcctgtggagagtataccaggcatcagagagactggttggaaacctagtgccaaggag
aaaagtaaagagctgaaagatccagatctgctctacaacatgctgaagaatctactggca
cagattaaaacgcatccagacgcctggccgttcatggagccggtgaagaaatctgaagct
ccagactattatgaggtcatccgctttcctatcgacttgaaaacgatgacggagcgtctg
aagaaccggtattacgtgacaaaaaagctgtttatcgccgacctgcagcgagtgatcacc
aactgcagagagtacaaccctccggacagcgagtactgcaagtctgcaaacaccctggag
aagtttttctacttcaagctgaaagaagccggacttattgacaagtaa

DBGET integrated database retrieval system