KEGG   Danio rerio (zebrafish): 555517Help
Entry
555517            CDS       T01004                                 

Gene name
kat2a, gb:dq017634, im:7156024
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dre  Danio rerio (zebrafish)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    555517 (kat2a)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     555517 (kat2a)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     555517 (kat2a)
Chromosome [BR:dre03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    555517 (kat2a)
   HAT complexes
    PCAF complex
     555517 (kat2a)
    STAGA complex
     555517 (kat2a)
    TFTC complex
     555517 (kat2a)
    SAGA complex
     555517 (kat2a)
    SLIK complex
     555517 (kat2a)
    ADA-HAT complex
     555517 (kat2a)
    HAT-A2 complex
     555517 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
3
AA seq 795 aa AA seqDB search
MADPAAQSSAQPRLQQAQSSGPTGSNSNPGAGSSDPARPGLSQQQWSSQKKAQVRSFPRA
KKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSH
LENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMGKPVVEGS
LGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRA
QKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVE
KDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSPVSI
SGSPHSKGSSASALGVTGLDVASSEPTIGEKRKLPEALTLEDAKRIRVMGDIPMELVNEV
MKTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVG
LQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVT
SNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYI
KDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPGLTCFKEGVRQ
IPVESIPGIRETGWKPSAKEKSKELKDPDLLYNMLKNLLAQIKTHPDAWPFMEPVKKSEA
PDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKSANTLE
KFFYFKLKEAGLIDK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcggacccggcggcacagagctccgcgcagccccggcttcagcaagcgcagtccagc
ggcccgaccggctccaactcgaaccccggagccgggagcagcgacccggcccgaccgggc
ctaagccaacagcaatggtccagccagaagaaagcccaagtccgttcgtttccgcgggcg
aaaaagctggagaaactcggagtgttttcatcctgcaaggcgaatgatgcttgcaagtgc
aatggctggaaaaaccccaatccaccaacagcggctcgtatggagctccagcagcaggcc
gccagtctgacggagacctgccgaagctgtggacactctttggcggagcatgtgtcccac
ctggaaaacgtgtctgaggaggagattaaccggctgttggggatggtggtggatgtggag
aatctcttcatgtctgtccataaagaagaagacacggacaccaagcaagtctacttttat
ttgtttaagctgctgaggaagtgtattctgcagatggggaaaccagtggtggagggctct
ctcggtagccctcctttcgaaaaacccaacatagagcagggggtgttgaactttgttcag
tataagttcagtcatttggctcctaaagagaggcagaccatgtatgagctcagtaagatg
tttctcctctgtctgaactactggaagctggagacaccgtcacagtttcggcagagggct
cagaaagaggacgcagcggcatacaaagtcgattatactaggtggctgtgttactgtcac
gttcctcagagcaatgacagcttgccacggtatgagacctgtcaggtgttcggccgcagt
ttgctgaagtccatcttcactgtcacccgcagacagttactggagaagttcagagtggag
aaagacaaactgccgccagagaaacgcaccctcatcctcacacattttccaaagtttctt
tccatgttggaagaggaaatctatggagaaaactctcccatctgggaggcagacttcacc
atgccagcctcagagggcacacaactgggccatcaaacagtactgagtccagtgtccatc
tccggctctcctcacagtaagggcagcagcgcctctgctctgggtgttacaggtttggac
gtagcttcctctgaaccaacaatcggtgagaagcgaaagctgcctgaagcgctgactctg
gaggatgccaagcggatccgagtaatgggtgatattcccatggagctggtcaatgaagtt
atgaagaccatcacagaccctgctgccatgctgggccctgagaccagtctgctgtctgca
aacgcagctcgcgatgaaacggctcgtctggaggagaggagaggcatcattgagttccat
gtgatcggtaactcgctctctcagaagtcaaataagaagattctaatgtggctcgtgggc
ttgcaaaatgttttctcccatcagcttccccgcatgcccaaagagtacatcacgcgcctt
gtgtttgacccgaagcacaagacgttggctctgattaaagatggccgcgtgattggaggg
atctgctttaggatgtttcccactcagggattcacagagattgtcttttgtgctgtcacc
tccaatgaacaggtcaagggctacgggacacatctgatgaatcatcttaaagagtatcac
atcaagcacggaattctgtacttcctcacgtatgcggacgaatacgccatcggctacttc
aagaaacagggcttctccaaagacatcaaagtgccgaagagccgctacctcggctacatc
aaagactatgagggagccacgctgatggagtgcgagctcaatccccgaattccctacacc
gaactctcgcacatcatcaagaggcagaaagagatcattaagaaactgatcgagaggaaa
cagaatcagatcaggaaagtgtatcctggtctcacctgctttaaagagggtgtgcggcag
attcctgtggagagtataccaggcatcagagagactggttggaaacctagtgccaaggag
aaaagtaaagagctgaaagatccagatctgctctacaacatgctgaagaatctactggca
cagattaaaacgcatccagacgcctggccgttcatggagccggtgaagaaatctgaagct
ccagactattatgaggtcatccgctttcctatcgacttgaaaacgatgacggagcgtctg
aagaaccggtattacgtgacaaaaaagctgtttatcgccgacctgcagcgagtgatcacc
aactgcagagagtacaaccctccggacagcgagtactgcaagtctgcaaacaccctggag
aagtttttctacttcaagctgaaagaagccggacttattgacaagtaa

DBGET integrated database retrieval system