KEGG   Danio rerio (zebrafish): 555578Help
Entry
555578            CDS       T01004                                 

Gene name
rxraa, RXRalpha-B
Definition
retinoid X receptor, alpha a
Orthology
K08524  
retinoid X receptor alpha
Organism
dre  Danio rerio (zebrafish)
Pathway
PPAR signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    555578 (rxraa)
   03320 PPAR signaling pathway
    555578 (rxraa)
Transcription factors [BR:dre03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    555578 (rxraa)
Nuclear receptors [BR:dre03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   555578 (rxraa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
21
AA seq 458 aa AA seqDB search
MLLSAFLPTDCTGQVTSSPLSSPTSHRGMHPSLLSPTSLGPSGSLHSPISTLSSPMNGLG
SPFSVISSPMGPHSMASPGVGYGPSISPQLNSPMNSVSSSEDIKPPLGLNGVMKVPAQPS
GTPLSLTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCVIDKRQR
NRCQYCRYQKCLAMGMKREAVQEERQRAKERSENEVESTSSANEDMPVEKILEAELAVEP
KTETYIETNVPMPSNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAG
WNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDK
TELGCLRAIVLFNPDSKGLSNPGEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPA
LRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcttctttctgctttcctccccacagactgcactggacaggtgacatcctctcctctc
agctcacccacgtcccaccggggcatgcacccgtcactgctgagtccaacttcattaggc
ccctcggggtccctgcactcccccatcagcactctgagctcacctatgaatggcctgggc
tctcccttctccgtcatcagctcgcctatggggcctcattcaatggcatctcctggagtg
ggttacggccccagtatcagccctcagttgaactcgcccatgaactctgtcagcagctca
gaggatattaagccgcccttaggcctcaacggtgtgatgaaggttccagcccagccctcg
ggcaccccactctctctcaccaaacacatctgtgccatctgtggcgaccgctcctcaggt
aaacactacggtgtgtacagctgcgagggatgtaagggtttcttcaagaggacagtgcgt
aaagacctgacctacacctgtcgagacaataaggactgtgttatagacaaacgccagcgc
aaccgctgccagtactgccgctatcagaagtgtttggccatgggcatgaagagagaagcc
gtccaggaggagcgccagcgagccaaggaacgcagtgagaacgaagtggagtcgaccagc
agcgccaatgaagacatgcccgtggagaagatactggaagcagagcttgctgtggagccc
aagacggaaacttacattgagactaatgtacccatgccatcaaattcacccaacgatcca
gtcaccaacatttgtcaggctgcagacaagcagctctttactctggtggagtgggcgaag
aggattccacacttttctgagctcccgcttgacgaccaggtcattctactacgagcagga
tggaatgagctcctcattgcgtcattttcgcaccgatccatagcagtgaaagatggaata
ctgttggccacaggattacatgtgcaccgaaacagcgcccacagtgccggagtaggagcc
atatttgacagagtgctgacggagttggtatcaaagatgagagacatgcagatggataaa
acagagcttggatgtcttcgagccattgtactatttaacccagactccaaaggcctgtca
aaccctggtgaagtggaagcactgagagagaaggtctatgcctctctggaagcttactgc
aaacataagtaccctgaacaacctggaaggtttgctaagctgttgctgcggctccctgca
ctgcgctctatcggactcaagtgtttggagcatctgttcttcttcaagctcataggcgac
acacccatcgacaccttcctcatggagatgctagaagctccacaccaaatgacataa

DBGET integrated database retrieval system