KEGG   Danio rerio (zebrafish): 555840Help
Entry
555840            CDS       T01004                                 

Gene name
pdk1, si:zfos-979f1.3
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     555840 (pdk1)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   555840 (pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
9
AA seq 405 aa AA seqDB search
MRIFRTLLNAASKQIDFYSRFSPSPLSMKQFIDFGSENACEKTSFTFLRQELPVRLANIM
KEIDLLPDNLLRTPSVRLVQSWYMQSFQDILEFKDKDADDETVNHDFTDAVIKIRNRHND
VVPTMAQGVVEYKETYGTDPITSQNMQYFLDRFYMSRISIRMLLNQHTLLFGGKVRDNPA
HPKQIGSIDPSCRVTDVVKDAYENARNLCDRYYMNSPELVLEEFNVKGPDKPVTVVYVPS
HLYHMVFELFKNAMRATMELYEDAMEYPPVHVQIVLGHEDLTVKVSDRGGGVPLRKIDRL
FTYTYSTAPRPQMDTSRATPLAGYGYGLPISRLYARYFQGDLKLYSMEGFGTDAVIYIRA
LSTDSIERLPVYNKSAWKHYKTIHEADDWCVPSKEPKDMTTFRSF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcttcaggactttactgaacgcagcgtccaagcaaatcgacttctactccaga
ttctctccttctcctctgtctatgaagcagttcatagattttggttcggagaacgcctgt
gagaaaacgtcatttacattcttaaggcaggagctgcccgtcaggctggcgaatataatg
aaagaaatcgacttgcttcctgacaaccttctgagaactccttcagtgcggctggtgcag
agctggtacatgcaaagttttcaggatatactggaattcaaggacaaggatgctgacgat
gaaacagtcaatcatgatttcacagatgctgtgattaagatcagaaaccgccacaatgat
gtggtgcccaccatggctcagggtgttgtggaatacaaggagacctacggcactgacccc
atcaccagtcagaatatgcagtactttctggaccgtttctacatgagcaggatttcaatc
agaatgctcctgaaccagcacactcttctgttcggaggaaaggtgagggacaatcctgct
catcccaaacagatcggcagcattgaccccagctgtcgggtcacggatgtggtaaaagat
gcttatgaaaatgcccgaaacctgtgtgaccggtattatatgaactcgcccgagctagtg
ttggaggaatttaatgttaaaggaccagataaacccgttactgtggtttatgtaccatct
catctctaccacatggtgtttgagctctttaagaatgccatgcgcgctaccatggagctt
tatgaagatgccatggagtatcccccagtgcatgtgcagatcgtcctcggccatgaagac
ttgactgttaaggtcagtgatcgaggaggcggagtcccgctgaggaagattgacaggttg
tttacatacacctactccacagcccctcgtcctcagatggacacatctcgagccactcca
ctggctggttatggttatgggctgcccatctccagactttatgccagatatttccagggt
gacctgaaactttattctatggagggatttggcacagatgctgttatttacatccgagct
ttgtccaccgactccatcgagaggcttccagtttacaacaaatcagcctggaaacattat
aagaccatccacgaggctgatgactggtgtgtgcccagcaaagagcccaaagacatgacc
accttccgcagcttctag

DBGET integrated database retrieval system