KEGG   Danio rerio (zebrafish): 555840Help
Entry
555840            CDS       T01004                                 

Gene name
pdk1, si:zfos-979f1.3
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
dre  Danio rerio (zebrafish)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
UniProt: 
Position
9
AA seq 405 aa AA seqDB search
MRIFRTLLNAASKQIDFYSRFSPSPLSMKQFIDFGSENACEKTSFTFLRQELPVRLANIM
KEIDLLPDNLLRTPSVRLVQSWYMQSFQDILEFKDKDADDETVNHDFTDAVIKIRNRHND
VVPTMAQGVVEYKETYGTDPITSQNMQYFLDRFYMSRISIRMLLNQHTLLFGGKVRDNPA
HPKQIGSIDPSCRVTDVVKDAYENARNLCDRYYMNSPELVLEEFNVKGPDKPVTVVYVPS
HLYHMVFELFKNAMRATMELYEDAMEYPPVHVQIVLGHEDLTVKVSDRGGGVPLRKIDRL
FTYTYSTAPRPQMDTSRATPLAGYGYGLPISRLYARYFQGDLKLYSMEGFGTDAVIYIRA
LSTDSIERLPVYNKSAWKHYKTIHEADDWCVPSKEPKDMTTFRSF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcttcaggactttactgaacgcagcgtccaagcaaatcgacttctactccaga
ttctctccttctcctctgtctatgaagcagttcatagattttggttcggagaacgcctgt
gagaaaacgtcatttacattcttaaggcaggagctgcccgtcaggctggcgaatataatg
aaagaaatcgacttgcttcctgacaaccttctgagaactccttcagtgcggctggtgcag
agctggtacatgcaaagttttcaggatatactggaattcaaggacaaggatgctgacgat
gaaacagtcaatcatgatttcacagatgctgtgattaagatcagaaaccgccacaatgat
gtggtgcccaccatggctcagggtgttgtggaatacaaggagacctacggcactgacccc
atcaccagtcagaatatgcagtactttctggaccgtttctacatgagcaggatttcaatc
agaatgctcctgaaccagcacactcttctgttcggaggaaaggtgagggacaatcctgct
catcccaaacagatcggcagcattgaccccagctgtcgggtcacggatgtggtaaaagat
gcttatgaaaatgcccgaaacctgtgtgaccggtattatatgaactcgcccgagctagtg
ttggaggaatttaatgttaaaggaccagataaacccgttactgtggtttatgtaccatct
catctctaccacatggtgtttgagctctttaagaatgccatgcgcgctaccatggagctt
tatgaagatgccatggagtatcccccagtgcatgtgcagatcgtcctcggccatgaagac
ttgactgttaaggtcagtgatcgaggaggcggagtcccgctgaggaagattgacaggttg
tttacatacacctactccacagcccctcgtcctcagatggacacatctcgagccactcca
ctggctggttatggttatgggctgcccatctccagactttatgccagatatttccagggt
gacctgaaactttattctatggagggatttggcacagatgctgttatttacatccgagct
ttgtccaccgactccatcgagaggcttccagtttacaacaaatcagcctggaaacattat
aagaccatccacgaggctgatgactggtgtgtgcccagcaaagagcccaaagacatgacc
accttccgcagcttctag

DBGET integrated database retrieval system