KEGG   Danio rerio (zebrafish): 556048Help
Entry
556048            CDS       T01004                                 

Gene name
tesk1
Definition
si:ch211-113e8.3
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     556048 (tesk1)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: TKL group
  LISK family [Table]
   556048 (tesk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
1
AA seq 657 aa AA seqDB search
MDQDENQEPCEPPLHALYGPNRIRPSSYRALRSAVSSLARIDDFFCEKIGSGFFSEVFKV
QHRITGQVMALKMNTLASNKANMLREVQLMNRLCHPNILRFLGVCVHEGQLHALTEYING
GNLEQLLDSDIYLSWTVRIGLSLDIARGLQYLHSKGIFHRDLTSKNCLVRCENGAFTAVV
GDFGLAEKIPDYSDGVEKQPLAVVGSPYWMAPEMLRGELYNEKVDVFAYGIILCEIIARI
EADPDILPRTEDFGLDVDTFEHMVGDCPPSFLQMAVDCCNMNADSRPAFSEIVVMLERIE
RERVKSEIPVILEPIAIDVSPYRRRSSPCHPCDQRLSRSQSDMLPPATSPCLGTPARVNP
FSLRQDLNGGRIKLFDTPSKSVISLTFTLPPPPDPSASPPLSGSPGLRGPPRRCRSLPCT
PELGRQLPFRDQEVEEDRSEELGQETKDKELEGQQDAVEDSGLVLDLDMVSLERVEEEEE
DEEVEKEGQSLTEPMDCSSSPDTTEGNVSGKRLISGSSYSSSLQSNGWATPISNGPPLLP
PLPRLDNNNGVLRPGRPFAWVRLNGYRGPAPEPLPPTEQDDVISCPACCLAGFSFPSLCL
RGAPPSRRGPPRRPYRTFNGGDASTATAKGLLCRGATGLAPSTASCEPGLPLPEAQT
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagatgagaaccaagaaccatgcgaaccccctttgcatgccctttacgggcct
aaccggattcggccttcttcgtaccgggctctgcgcagtgccgtgtccagcctggcacgg
attgacgattttttctgtgaaaaaatcggctcagggttcttctcagaagtgtttaaggtg
cagcacaggatcactgggcaggtgatggctctgaagatgaacacactggccagtaacaaa
gccaatatgctgagagaggtgcaactcatgaaccgactctgccaccccaacattctcagg
tttttgggggtgtgtgttcatgaaggacagcttcatgctcttacagagtacataaatggt
ggcaacctggagcagctgctggacagtgacatatatctgtcatggactgtgagaatcggt
ctgtcccttgacattgctagaggactgcagtaccttcacagcaagggcattttccaccga
gaccttacatcaaagaattgtctggtgcgttgtgaaaatggtgcttttacagctgtggtt
ggggactttgggctggcagagaaaatccctgattacagtgatggggttgaaaaacaacct
ttagccgttgtgggctccccctactggatggctccagaaatgttaagaggagagctgtac
aatgagaaggtggatgtctttgcatatggaataatcctttgtgagattattgctcgaatt
gaggctgacccagatatcctcccacggacagaggattttggactggatgtggacacattt
gagcatatggtgggagactgtccaccttcatttcttcaaatggctgtcgactgctgcaat
atgaatgcagacagtcgtcctgccttctctgaaattgtagtgatgctcgagaggatagaa
agagaacgagtgaagagtgaaattccagtcatcctggaacccattgccattgacgtcagc
ccatatcgaaggagaagctcgccatgccatccctgtgaccagcgcctgtcccgcagccag
tcagatatgcttcctcctgccacttccccatgtttaggcacacctgcaagggtcaaccca
ttctctcttcggcaagacctcaacggtggccgcatcaagctgtttgacacccctagcaaa
tccgtcatttcccttacctttacccttccaccacctccagacccctctgcgtctccaccg
ctgagcgggagcccagggcttcgaggaccccctcgaaggtgtcggtccctgccctgcacc
cctgaactaggacgacagttacccttcagagatcaagaggtagaagaagatcggagtgaa
gaactgggccaggaaacgaaagacaaagagttggaaggacaacaagatgcggtggaggac
tcaggcctggttctggacttagatatggtgtctttagaacgggttgaggaggaagaggag
gatgaagaggtggagaaagaaggacaaagtctcaccgagcccatggactgcagtagctca
cctgacacgactgaaggaaatgtttcagggaagcgtttaatcagcggatcatcttattcc
tcgtccttgcagtccaatggttgggctacacccatctctaatggaccaccattattacct
cctcttcctcgtttggacaataataatggagttctgaggcctggacgtccatttgcatgg
gtgagactgaacgggtaccgaggccctgctccagaacctttaccgcctaccgaacaagac
gatgtgatttcgtgtccagcctgctgtctggccggcttcagcttcccttccttgtgcctg
cgtggagctcctccatcacgccgtgggcctccacgaagaccctacaggacctttaacgga
ggggatgcatccacagccacagcaaagggactgctctgtcggggagcgacaggtctggct
ccgtccactgcatcgtgtgagccagggttacctctaccagaggcccaaacctaa

DBGET integrated database retrieval system