KEGG   Danio rerio (zebrafish): 556162Help
Entry
556162            CDS       T01004                                 

Gene name
pdia5, sb:cb441, wu:fb98h09, zgc:172235
Definition
protein disulfide isomerase family A, member 5 (EC:5.3.4.1)
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     556162 (pdia5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
9
AA seq 528 aa AA seqDB search
MASWNRHGRRRRLVEMFIFLSLVAVTSALQAVKVSPLIEKVNDHKDFKKLLRTRTNVLVL
YTKSASSGDAHLKLLSDVAQAVKGQGTIAWVNCGDSEGRKLCKKVKVDPSSKTKGVELLH
YKDGTFHTEYNRPATFKSMVAFLKDPAGAPLWEENPEAKDVVHIESEKDFRKLLKREERP
ILMMFYAPWCGVCKRMQPIFQQAATETKGKYVLAGMNVHPAEFDGVKQEFSVKGYPTFCY
FEKGKFLHHYENYGATSKDITDWLKNPQPPQPKTPEVPWSESGSAVFHLTDDSFDSFLEE
HPSALIMFYAPWCGHCKKMKPEYDDAAETLNKDPNSPGVLAAVDTTIHKSTGERFKISGF
PTVKYFEKGEEKYTLPHLRSKDKIIEWLKNPQAPPPPEKSWDEMPSSVSHLGAEDFRESL
KKKKHALVMFYAPWCPHCKNAVPHFTTAAEMFKEDRKIAYAAVDCTKGQNHELCKQEGVE
GYPTFNYYNYGKFSEKYNGERGEAGFTGFMRNLRGRDQEKVGKRKEEL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttggaaccgacacgggagacgtaggagactggtcgaaatgttcatattcctg
tcattggttgcagtgacgtccgccctgcaggcagtgaaggtttctccactcatagaaaaa
gtcaatgaccataaggatttcaagaaacttcttaggaccagaactaatgttcttgtttta
tacaccaagtcagcctcatctggagatgctcatctaaagctgctgtctgatgtggctcag
gctgtgaaaggtcaagggaccatcgcttgggtgaattgtggggattcagaaggccgcaaa
ctctgtaaaaaagtcaaggtagaccccagctcgaaaaccaaaggagttgagctcctgcat
tacaaggatgggactttccacacagaatacaacagaccagccacatttaagtccatggtg
gcgtttctgaaagaccctgcaggtgcccccctgtgggaggagaaccctgaggccaaagat
gttgttcacatcgagtcagagaaggatttccgaaaactgctaaaaagagaggagaggcca
atcctcatgatgttttacgccccatggtgtggagtatgtaaaaggatgcagcccattttc
caacaagcagccacagagactaaaggaaaatatgtgttggctgggatgaacgtgcacccg
gcagagtttgatggcgtcaaacaggagttcagcgtcaagggctatccaaccttctgctac
tttgagaaggggaagttcttgcatcactatgagaattatggagccacgtccaaagacatc
actgattggttgaaaaaccctcagccgccacaacctaagactccagaggtgccctggtct
gagtctggctcggcggtcttccatctgaccgatgactctttcgactcattcctggaagaa
catccgtcagccctgattatgttctatgctccatggtgtggccactgtaaaaagatgaag
ccagagtatgacgatgctgctgagaccctcaacaaagacccaaatagtccaggtgtattg
gcagcggtagatactaccattcacaagtccactggcgagcgttttaagatctcaggcttc
cctacagtgaagtattttgaaaaaggagaggaaaagtacacgcttcctcatctccggagc
aaagataagatcatcgagtggctgaaaaatccccaggctccacctcctccagaaaagtca
tgggatgagatgccgtccagcgtgagccacctgggagccgaagatttcagggaatcgctg
aaaaagaagaaacacgccttggtcatgttttatgctccatggtgtccgcactgcaagaat
gccgtccctcatttcaccacagcagcagagatgttcaaagaagaccgtaagattgcatat
gctgcagtggactgcacaaaaggacagaatcatgagttgtgtaaacaggagggagttgaa
ggctatccaacattcaactactacaactatggaaagttcagcgaaaaatacaatggggaa
agaggggaagctggctttactggtttcatgaggaatctcaggggccgagaccaagaaaaa
gtgggcaagcggaaagaggagctctag

DBGET integrated database retrieval system