KEGG   Danio rerio (zebrafish): 556212Help
Entry
556212            CDS       T01004                                 

Gene name
dyrk1b, si:ch211-225p5.1
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B (EC:2.7.12.1)
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
dre  Danio rerio (zebrafish)
Brite
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     556212 (dyrk1b)
Protein kinases [BR:dre01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   556212 (dyrk1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
UniProt: 
Position
16
AA seq 681 aa AA seqDB search
MSSQHSHPSFSNIHSMADQQQVLSDMTILQRRIPPSFRDPASAPLRKLSVDLIKTYKHIN
EVYYTKKKRRAQQVPPEDSSTKKERKVYNDGYDDDNYDYIVKNGEKWLDRYEIDSLIGKG
SFGQVVKAYDHHEQEWVAIKIIKNKKAFLNQAQIELRLLELMNKHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNKIVEVLGVPPNHMLDQAPKARKYFDKLSDGLWTVKKN
KDIKKVLYPSASEYKPPATRRLHEILGVETGGPGGRRAGEQGHAPCDYLKFKDLILRMLD
YDPKTRITPFYALQHNFFKKTTDEGTNTSSSTSTSPAMDHSHSTSTTSSVSSSGGSSGSS
NDNRNYRYSNRYYNSAVTHTDYEMQSPQAPSQQQLRIWPGGDSSMGQLSNSGSDSSYPQL
LLHKPAATQHSRHFLGNIGGMMEPHHPHPIYGSHHSNGRQLRQQQQQQNQPQGQASQGQQ
GTALMPVSSPQMQDSIELSLTHHHHLGQSSIMQPPPSSLDSSQYGSSNLHLGLSAFRTRT
ESSMMAVCGSGSGSGQSAANS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagccagcacagccacccctccttcagtaacatccactccatggccgaccagcag
caggtgctgtcagatatgaccatcctgcagaggaggattcccccaagttttcgagatccc
gccagcgccccgctacgaaaactctcagtcgatctcatcaagacatataagcacatcaat
gaggtgtattacacgaaaaagaaacggcgagcccagcaggttcctcctgaagactccagc
accaaaaaagagcgcaaagtgtacaacgacggctatgacgacgacaactatgactacatt
gtgaagaacggggagaagtggctggaccgctacgagatcgattcacttattggcaagggc
tcatttggacaggtggtgaaagcctatgaccaccacgagcaggagtgggtggccatcaag
atcatcaagaacaagaaagccttcctgaaccaggcccagatcgagctgcggcttcttgag
ctcatgaacaaacatgacactgagatgaagtactacatagtccacttaaagaggcacttc
atgttccgtaaccacctgtgcctggtgtttgagcttctctcctacaacctgtacgacctc
ctgcgcaacaccaacttccgcggcgtctcgctcaacctgacgcgcaagttcgctcagcag
ctgtgcacggcgctgctcttcctggccacacccgagctcagcatcatccactgcgacctc
aagccggagaacatcctcctctgcaaccccaagcgcagcgccatcaagattgtggacttc
ggcagctcctgccagctaggacagaggatttaccagtacatccagagccggttttaccgc
tctccagaggtgttactgggcatgccgtatgacctggctatagacatgtggtctctgggc
tgtatcctggtggagatgcatacgggcgaaccgctctttagtggctccaatgaggtggac
cagatgaataaaatagtggaggtgctgggggtcccgcccaaccatatgctggatcaggcc
cctaaagcacgcaaatacttcgacaagctgtccgacggcctctggaccgtcaagaagaac
aaggacattaagaaggtactttatccttcggcctctgaatataaaccaccggccacgcga
cgattgcatgagatcctgggggtggagacgggaggtccgggtgggaggcgagctggagaa
cagggtcacgcaccctgcgactacctgaagttcaaggacctgatcctgcgtatgctggac
tatgatcccaagacgcgcatcacgcccttttacgcgctgcagcacaacttctttaagaag
acgacagacgagggcaccaacaccagcagctccacctccaccagccctgccatggaccac
agccactccacctccaccacgagctctgtctccagctctggtggatctagcggttcttcc
aatgacaaccgaaattaccggtacagcaaccggtactacaacagcgcagtcactcacaca
gactatgagatgcagagcccacaagctccgtctcagcagcagctgcgcatctggccagga
ggggacagcagcatgggtcagctgtccaacagcggcagcgactcctcctacccgcagctg
ctgttgcacaagccggcggccacgcagcactcgcgccacttcctgggcaacatcgggggc
atgatggagccgcaccaccctcaccccatctacggcagccaccacagcaacggcagacag
cttcgacagcagcagcagcagcagaaccagccgcagggccaggcctcgcagggccagcag
ggcacagcgctgatgcccgtctcctccccgcagatgcaggacagcatcgagctcagcctc
acccaccaccaccacctgggtcagtcttccatcatgcagccgcccccgtcgagcttggac
tccagtcagtacggctcctccaacctccacctgggcctctctgcctttcggactaggaca
gagtcctccatgatggcagtgtgcggcagcgggagtgggagcggtcagagtgcagccaac
tcttga

DBGET integrated database retrieval system