KEGG   Danio rerio (zebrafish): 556236Help
Entry
556236            CDS       T01004                                 

Gene name
acacb, si:ch211-250o15.3
Definition
acetyl-CoA carboxylase beta
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
dre  Danio rerio (zebrafish)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    556236 (acacb)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    556236 (acacb)
   00640 Propanoate metabolism
    556236 (acacb)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    556236 (acacb)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    556236 (acacb)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    556236 (acacb)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     556236 (acacb)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     556236 (acacb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
Vega: 
Position
5
AA seq 2378 aa AA seqDB search
MPSQTPISDCAGEHSPPMDPGLSSTSPRNEGIPPSATSDPTDQSNITVSHIESHRPRFGS
GAQAKEKLKFILGASEDNSSDDEPLVKNQTTTHQPKNTETLNAEPTASSEMPPTPVPSTG
LRPSMSGPHLLKKGKEHRKMEVHRDFTVASPAEFVTRFGGNRIIDKVLIANNGIAAVKCM
RSIRRWSYEMFRNERTIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVEMIV
DIAKRIPVQAVWAGWGHASENPKLPELLHKSGICFLGPSSKAMWALGDKVASSIVAQSAG
IPTLPWSGTGLSVEWAEEEQRQGRLISVPPELYVQGCVKDVDEGLASAEKIGYPVVIKAS
EGGGGKGIRKVESSEDFPSLFRQVQAEVPGSPIFIMQLAEHARHLEVQILADQYGNAISL
FGRDCSIQRRHQKIIEEAPASIASTITFEQMEQYAVRLAKMVGYVSAGTVEYLFSEDGSF
HFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGIPLYRIKDIRVLFGEAPWGDTTINFE
SPECMPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVGATGGLHEFA
DSQFGHCFSWGENREEAISNMVVAMKELSIRGDFRTTVEYLIKLLETESFRNNDIDTGWL
DHLIADKVQAERPDTMLGVVCGALQVADASFRESMSDFLHSLERGQVLPAASLVNTVNVD
LIYDGVKYCLKVARQSPTTYVIIMNDSDIEVDVHRLSDGGLLLSYGGSSYTTYMKEEIDR
YRVTVGNKTCVFEKERDPTVLRSPSAGKLLQYVVTDGSHVSASQPYAEIEVMKMVMTLHV
QHSGCIRFLKRPGTVLEPGCIVALMDLDDPSCIHQVKPNTEPLPAQEPLPMVGERLHQVF
HNVLENLVKIMDGYCLPEPYFSQKLKNWVDTLMKTLRDPSLPLLELQEIMTSVAGRIPVT
VEKAIRKVMAQYASNITSVLCQFPSQRIANILDSHAATLQRKADREIFFMNTQSIVQLVQ
RYRSGIRGYMKSVVLDLLKHYLQVEMQFQQAHYDKCVINLREQYKPDMTPVLECIFSHAQ
VSKKNILVTMLIDQLCGRDPMLADELMVILDELTQLSKMENSKVALRARQVLIASHLPSY
ELRHNQVESIFLSAIDMYGHQFCPENLKKLILSETSIFDVLPSFFYHNNRVVCMAALEVY
VRRAYIAYELNSLQHHQLQDGTCAVDFQFMLPSSHPNREPNATVSQHMPKSTLTLPVNDS
GEFPAMRRQGSELFLEGALSPPCQRMGAMVAFHSFDHFKRCFDEVICRFVDPLCESSLFF
DGCSTFCDGESCKNMKENPIHIINVSIKQADTEDDDALVTAFTAFAHSKKSLLYDYGIRR
VTFLVAQKREFPKYFTFRARDEFHEDRIYRNLEPALAFQLELNRMRNFDLKAVPCAHHRM
QLYLGAARVEEGAEVTDYRFFIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAF
SNTPTRTDCNHIFLNFVPTVIMDPYKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTT
TGDVIPIRLFLTNESGYYLDISLYKEVNDPSSGQIMFQSYGDKQGPLNGMLINTPYVTKD
LLQAKRFQAQSLGTTYVYDFPEMFRQALFKLWGPGDSYPKDVLMCNELVLDSQGNLVQMN
RLPGDNEVGMVAFRMRMKTPEYPEGRDIIVICNDITHMIGSFGPQEDQLFMRASELARAE
GIPRIYISANSGARIGLAEEIRHMFQVAWIDPEDPYKGFKYLYLTPQDYTRISSSNSVHC
HHVEEGGESRYILTDIIGKEEGIGVENLRGSGTIAGETSQAYKEIITISMVTCRAIGIGA
YLVRLGQRVIQVENSHIILTGAGALNKVLGREVYTSNNQLGGVQIMHNNGVTHSTVPDDF
EGVLTILQWLSYMPKSNQSPVPIKPATDPVDREIDFVPTKAPYDPRWLLCGRPHPTVKGA
WQSGFFDHGSFLEIMATWAQTVVVGRARLGGIPLGVIAVETRTVELAIPADPANLDSEAK
LLQQAGQVWFPDSAYKTAQAIEDFNREKLPLMVFANWRGFSGGMKDMYDQVLKFGSYIVD
ALREFSQPVLVYIPPNAELRGGSWVVIDPTINLQHMELYADRESRGGVLEAEGTVEIKFR
KKDLLKTMRRIDPVYSRLAEQLGKPDLPSQERKDLEAKLKSREEFLLPIYHQVAVQFVDL
HDTPGRMQEKGVITDILDWKTARSFFYWRLRRLLLEEVVKKEIMQANQDLSNGHIQSMLR
RWFVETEGAVKAYLWDNNKVVVEWLENNLSQQDGTRSVIRENIKCIKRDYALKHIRSLVQ
ANPEVTMDCIIHMAQNITPSQRAKVCHLLATMDNSTTS
NT seq 7137 nt NT seq  +upstreamnt  +downstreamnt
atgccatcacaaacacccatctcagattgtgcaggggaacattctccaccaatggacccc
ggattatcaagcacttcaccaagaaacgagggaattcctccatcagcaactagcgatccc
actgaccaatcaaatatcacagtttcccatattgaatcccacaggcccaggtttggttct
ggtgctcaggctaaagaaaaactgaagtttattttgggtgcttctgaagataattcctct
gatgatgagcctctggttaagaaccaaaccaccacacatcagcccaaaaacacagagaca
cttaatgctgaacctaccgcatcatcagaaatgccgccaacaccagttccatcgacgggt
ttaaggcctagcatgtcaggcccccacctgctgaaaaagggcaaagaacacaggaagatg
gaggtgcatagagatttcaccgttgcctctccagcggagtttgtcactcgctttggagga
aaccgcattatagataaggtgctgattgcaaataatggcattgctgcagttaagtgcatg
cggtcaattcgccgctggtcctatgaaatgtttcgtaatgagagaaccattcgctttgtg
gtgatggtcacacccgaagacttgaaagccaatgcagaatacattaaaatggctgatcac
tatgtgccagtaccagggggtccaaataacaacaactatgccaatgttgagatgattgtg
gatattgcaaaaaggataccagtgcaggctgtgtgggctggatggggacatgcatctgag
aaccccaaactaccagagctccttcataaatcagggatatgttttctaggaccgtccagt
aaagccatgtgggcattaggagataaagtggcatcttcaatcgtagctcagagcgcaggc
attcccacgttgccctggagtggaactggtctgagtgttgaatgggcagaagaagagcag
aggcagggtcgtttgatcagcgttcctcctgaactatacgtgcagggttgtgttaaagat
gtggacgagggactagcgagtgcagaaaagattggctaccctgtggtcatcaaagcatca
gagggaggtggaggtaaaggcataagaaaagttgaaagttctgaagactttcctagcctt
ttcagacaggtgcaggctgaggtgccaggttcacccatcttcataatgcaactagccgaa
cacgcacgccacctggaggtgcagatcttggccgaccaatatggcaatgccatctctctg
tttggcagagactgttctatccagcgccgtcaccagaagatcatagaagaagctcctgcc
agcattgcctccaccatcacttttgagcaaatggagcagtatgcagttcgtctggctaaa
atggtgggctatgtgagcgctggtacggtggaatacctgttttctgaggatggaagtttc
cacttcctggagctgaatcctcgacttcaggtggagcatccttgtacggagatgattgct
gacgtcaaccttcctgcagcacagctacagatagcgatggggattcctctttacagaatt
aaggatatccgtgtcctgtttggtgaagctccatggggagacacaactattaactttgaa
tctccagaatgcatgccctgtccacggggacacgtcatagctgcacgcatcaccagtgaa
aacccggatgagggctttaaaccaagctcaggtacagttcaggagctgaacttccgtagc
agtaagaatgtatggggctactttagtgtaggtgcaactggaggcctacatgagtttgca
gactctcagtttggacactgtttctcctggggcgagaaccgagaagaggccatctcgaac
atggtggtagccatgaaggagctgtcaatcagaggagacttcaggacaacagtggagtac
cttataaaactgctggaaacagaaagtttcagaaacaatgacattgatactggttggctg
gatcaccttattgctgataaagtgcaggcagagaggccagatactatgttaggtgtggta
tgcggagctctacaagtggctgatgcaagttttagagaaagcatgtctgacttcctgcat
tcactggaaaggggtcaggtgttgccggctgctagtttggtcaacacagttaatgttgat
ctgatctatgatggcgtcaaatactgcctgaaggtagcccgtcagtcacctacgacatat
gttatcataatgaatgactccgatatagaagttgatgtccataggctcagtgatggtggt
ctactgctttcctatggcggcagcagctacacaacctacatgaaggaggagattgatagg
taccgtgtcacagtgggcaataaaacgtgcgtgtttgagaaggagcgagaccctacggtg
ctccgttcgccctctgctggcaagcttttgcagtatgtagtcactgatggttcacatgtt
tcggcttcccagccttatgctgaaattgaggtgatgaagatggtgatgaccctgcatgtc
cagcattctggttgtattcgctttttaaaaagaccaggaacagtattggagcctggctgt
atagtggccctaatggacctggatgaccccagctgtattcatcaggtgaaaccaaacaca
gagccattaccagctcaggagccattacccatggtaggagagaggcttcaccaggtgttc
cacaatgttctggagaacctggtgaaaattatggatggatattgtctgccagagccatat
tttagtcagaaattgaagaactgggtcgacacgctgatgaagacgcttcgggatccgtct
ctgcctctacttgaactgcaggagatcatgaccagcgtggcagggcgaattccagttact
gtggagaaggcaattcgaaaggtcatggcacagtacgccagtaacattacctctgtgctc
tgtcagttccccagccaaaggatagcaaatatacttgatagccatgctgccacacttcaa
aggaaagcagaccgggaaattttcttcatgaacacccagagcattgtgcaattggtgcaa
agataccgtagcggcattaggggctacatgaaatctgttgttctggatcttttgaaacac
taccttcaggtggagatgcaatttcagcaagctcactatgacaagtgtgtgatcaatctc
agagagcagtataagccggacatgaccccagtgctggagtgcatcttttctcatgctcag
gtgtccaagaagaacatcctcgtcaccatgctcatagaccagctgtgtggccgggaccca
atgcttgctgatgagctcatggtcattctggatgagcttacacaactcagtaaaatggaa
aactctaaagtggcacttagggccagacaggtgttgatcgcctctcatttgccctcatat
gaactcaggcacaaccaggtggaatccatctttttatcagctattgatatgtatgggcat
cagttttgtcctgaaaacctcaagaaactaatcctatctgagacctccatctttgacgtc
ttgcccagttttttctaccacaacaaccgtgtggtttgcatggctgcattagaggtttat
gtacggagggcttatatagcttacgagctaaacagtcttcagcaccatcagctgcaggat
gggacatgtgcggtggatttccagttcatgttaccatcatcccacccaaacagagagcct
aacgccacagtgagccagcacatgcccaaatccacactgacccttcctgtcaacgattcg
ggagagtttccggcaatgcgccgtcaaggcagtgagctctttctagagggggcgctttca
cccccctgccagaggatgggagccatggttgccttccatagctttgaccacttcaaaagg
tgctttgatgaagtgatctgtcgctttgtggatccgctgtgtgaaagttctctgtttttt
gatggctgttccaccttctgtgatggggagagctgtaaaaacatgaaggaaaaccccatt
cacatcataaatgtgtcaattaaacaagcagacacagaagatgatgatgctttggtcaca
gctttcactgcctttgctcactccaaaaaatcgctactctatgattacggaatcagaagg
gtgacatttttagttgcacaaaagcgggagttcccaaaatacttcacgtttagggccaga
gatgaattccatgaagacagaatctaccgtaacctggagcctgctctggccttccagctg
gagctgaaccgcatgcgtaactttgaccttaaggctgttccctgtgctcaccaccgcatg
cagctgtacttgggtgctgctcgtgtggaagagggcgcagaggtcactgattatcgcttc
tttatcagagccatcattcgccactctgacctcatcaccaaggaggcctcctttgagtat
ttgcagaatgagggtgagaggctgttgctggaggcgatggatgagctggaggtggccttt
agtaacacacccactcggactgactgcaatcacatcttcctcaattttgtacccactgtt
attatggacccatacaagatagaggagtctgtccgctccatggtgatgcgatacggtagt
cgactgtggaagctgcgagttctccaggctgagctgaaaatcaacatccgcctcaccacc
actggagatgttattcccatacgcctctttctcaccaatgagtctggatactatctggac
atcagcttgtataaagaggtcaatgacccatccagtggacagataatgttccagtcgtat
ggagacaaacaaggcccgctgaacggcatgctcataaacacaccatacgtcacaaaggat
ttactccaggccaagcgcttccaggctcagagcctcggcaccacatatgtctatgacttc
cctgagatgtttagacaggctttgtttaagctttggggaccaggagacagttatcctaaa
gatgtgttgatgtgtaatgagctggtcctggattctcaggggaaccttgtgcagatgaac
agactaccaggagacaatgaggttggaatggtagctttccggatgaggatgaagactcca
gagtacccagagggccgagatatcattgtgatctgtaatgatattacccatatgattggc
tcttttgggcctcaggaggatcagctttttatgcgagcatctgagctggccagagcggag
ggcatcccgcgcatctacatctcagccaacagcggagctcgaatcggcctggcagaggag
atccgccacatgtttcaggtggcttggatcgaccctgaagacccatataagggttttaag
tacctgtatctgactcctcaagactacacccgcatcagttcctccaattctgtccattgt
caccatgtagaggagggaggagagtccagatacatcctcacagacatcataggaaaggaa
gagggtattggagtggagaatctgaggggctcgggcacaatagctggagaaacttctcag
gcttataaagaaataatcactatcagcatggtcacgtgtcgggctataggaatcggtgcc
tatctggtacgtctaggacaaagagtcattcaagtggaaaactcccatatcatcctgact
ggagccggggcattaaacaaggtgctgggtcgtgaagtctacacctccaataaccagctt
ggtggggttcagatcatgcacaacaatggagtgacacactccaccgtgccagatgacttt
gaaggagtgctcactattctacagtggttatcctacatgccaaagagcaatcaaagtcca
gtcccaataaagcctgccactgatccagtcgacagagagatcgattttgttcccacaaaa
gccccttatgaccctcgctggctgctctgtggacgaccccatcccactgtgaagggagca
tggcagagtggattctttgatcatggttcatttttggagataatggctacatgggcacag
acagtggtggtgggccgagccaggcttggtgggattcctcttggggtcattgctgtggag
acccgcacagtcgagcttgccattccagcagatcctgccaacttagactcagaggccaag
ctcctccagcaagctggtcaggtgtggtttccagattctgcatataaaacggctcaggct
attgaggatttcaatagagagaaacttccccttatggtgtttgccaactggcgaggattt
tctggaggcatgaaagatatgtacgaccaggtgctcaagtttggctcttatatcgtggat
gccctgcgagaattcagccagcctgtgctggtttacattcctcctaatgctgagctgaga
ggaggatcatgggtcgtgatcgaccctactataaaccttcagcacatggagctctatgca
gatcgagaaagcagagggggcgttttggaggctgagggcacagtggagatcaaattcaga
aaaaaagacctgctaaagaccatgcgaaggattgatccagtgtattctcgtctggctgag
cagctaggcaaaccagacttaccgagccaggagcgtaaagacctggaggcaaaactaaag
tctagagaggagttccttcttcccatctaccaccaggtggcagtgcagtttgttgacctt
catgacactccaggacggatgcaggaaaagggagtcatcacggacatcctggactggaag
actgctaggtcattcttttactggcgtctgaggcgactgctgttggaggaagtggtaaag
aaggagatcatgcaggccaaccaagacctgagcaacggacacatacagtccatgctgcgc
cgctggtttgtggagacagaaggagctgtaaaagcatatctgtgggacaataacaaagtg
gtggtggagtggctggaaaacaacctgtcccagcaggacggaacacgttcggtcatcaga
gaaaacatcaaatgcataaagagggactacgctctcaaacacatccgcagcttagtccaa
gccaatccagaagtgactatggactgcatcattcacatggcacagaacattacgccttca
cagagagccaaagtctgtcacctgctggccaccatggacaactccaccaccagttga

DBGET integrated database retrieval system