KEGG   Danio rerio (zebrafish): 556286Help
Entry
556286            CDS       T01004                                 

Gene name
sos1, fj59e07, wu:fj59e07, zgc:158274
Definition
son of sevenless homolog 1 (Drosophila)
Orthology
K03099  
son of sevenless
Organism
dre  Danio rerio (zebrafish)
Pathway
MAPK signaling pathway
ErbB signaling pathway
FoxO signaling pathway
Dorso-ventral axis formation
Focal adhesion
Gap junction
Jak-STAT signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    556286 (sos1)
   04012 ErbB signaling pathway
    556286 (sos1)
   04630 Jak-STAT signaling pathway
    556286 (sos1)
   04068 FoxO signaling pathway
    556286 (sos1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    556286 (sos1)
  Cell communication
   04510 Focal adhesion
    556286 (sos1)
   04540 Gap junction
    556286 (sos1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    556286 (sos1)
   04912 GnRH signaling pathway
    556286 (sos1)
  Development
   04320 Dorso-ventral axis formation
    556286 (sos1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
11
AA seq 713 aa AA seqDB search
MQAPPFQYDFYSEENAHKWRGLLVPSLNKVLNQVHPKLSSQQEALQYIEGLILVLLNTLC
QAQPRTVQDVEERVQRSFPHPIEKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMLHPIE
IARQLTLLESDFYRAVQPSELVGSVWTKEDKEINSPNLLRMIRHTTNLTLWLEKCIVETE
NVEERVSVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEE
AHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGTELINFSKRRK
VAEITGEIQQYQNQPYCLRVENDIRKFFENLNPMEDMMEKEFTDYLFNKSLEIEPRNART
LPRFAKKYSCPLKSPGVRPSAVRPGAMRHPTPLQNEPRKISYSRIPDSETESSAASAPNS
PRTPLTPPPASAASTDTCSVFDSPQQPSSPFHSNSECVFAPVALPHGPRSSSVSSMMGFL
RNDDPPVPPPVPPRRRPESAPAESSPSKMMSTHLDSPPAIPPRQPTSSKVYSPRYSLTDP
PESPPLLPPREPVRTPDVFCSSPLHLQPPPPGRRAPELQAFFPPQTPSPSPLGPRKHPEP
PPEPPLGPPVPPRLSTAGPPAHIPKLPPKTYKRESVHREGPPPPLLLENANPT
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctccgccctttcagtatgacttctacagtgaggagaacgcgcacaagtggaga
ggcctgctggtgccgtcactcaacaaggtgcttaatcaggtgcacccgaagctgtcgtcc
cagcaggaggcgctgcagtacatcgaggggctgatcttggtgctgctcaacacactctgc
caggcacagcctcgcactgtacaggatgtggaggagcgtgtgcagaggagttttccacac
ccgatagagaaatgggcgatcgcagatgctcaggccgccatcgagaagaggaagaggagg
aacccgctggcgctgcccgtggacaagatacatccactgctcaaggaggttctgggctat
aagatcgaccaccaggtgtcggtgtacatcgtggcggtgctggagtacatctctgcagac
atactgaagctggctggaaactacgtcagaaacatccggcactatgagatctcacagcag
gacatcactgtggccatgtgtgctgataaggtgctgatggacatgctccaccccatcgag
atcgcccgccagctcacactgctggagtctgacttctacagggcggtgcagccgtcagag
ctggtgggaagcgtctggactaaagaagataaagagatcaactctccaaacctgctgagg
atgatcagacacaccaccaacctcacactctggctggagaagtgtatagtggagacggag
aatgtggaggagcgtgtgtccgtggtgtcgcgtatcattgagatcctgcaggtctttcag
gagctcaacaacttcaatggtgtgctggaggtggtgagcgccatgaactcctcacccgtc
tacaggctcgaccacaccttcgagcaaatccccagcagacagaggaagatcctggaggaa
gctcatgagctcagtgaagatcattataagaagtatctggccaagctcaggtccatcaac
ccaccctgtgtgcccttctttggcatttatttaacgaacatcttgaagacggaggaggga
aacccagacttcctgaagcgccacggcactgagctgatcaacttcagcaagaggaggaaa
gtggctgagattactggagagatccagcagtaccagaaccagccctactgtctgcgggtg
gagaacgacatccggaagttcttcgagaacctaaacccgatggaggacatgatggagaag
gagttcacagattacctgttcaacaaatctctggagatcgagccgcgcaatgcacgcaca
ctgcccagattcgccaagaagtacagctgtcctctgaagtctccgggggtccgtccgtcc
gcggtgcggccgggagcgatgcgacacccgacgccgctgcagaacgagccgcgcaagatc
agctacagccgcatccctgacagcgagacggagagcagcgcagcgtctgcaccaaactcc
cccagaacacccctgacacccccacccgcatccgctgcatccactgacacctgcagtgtg
ttcgactctccacagcagccctccagcccgttccactccaacagcgagtgtgtgttcgct
ccggtggctctgccgcacggcccacgatcctcttcagtgtcctctatgatgggttttctg
aggaatgatgatcctccagttcctcctcctgtcccgccgcgccgccggcccgagtctgcc
cccgccgagtcctcgccctccaagatgatgtcaacacacctggacagtcctcctgcgatt
ccccctcgtcagccgaccagcagtaaggtgtattctcctcgatactcgctgacggatcct
ccggagagcccacctctgctgccgccgcgggagccggtgcggaccccggacgtgttctgc
agctcgccgttacacctgcagccgccgccgccgggccgccgcgcccccgagctgcaggcc
ttcttcccaccacagacgccctcaccgtcaccgctggggccgcggaaacacccggagccg
ccgccggagcccccactggggccgcccgtccccccacgcctcagcaccgccggcccgccc
gcacacatccccaaactgcccccaaaaacatacaagagggagtcagtgcaccgcgagggt
ccgccgccgccactgctgctggagaacgccaaccccacatga

DBGET integrated database retrieval system