KEGG   Danio rerio (zebrafish): 556339Help
Entry
556339            CDS       T01004                                 

Definition
cGMP-dependent protein kinase 2-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dre  Danio rerio (zebrafish)
Pathway
Gap junction
Class
Cellular Processes; Cell communication; Gap junction [PATH:dre04540]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 771 aa AA seqDB search
MVPSHSLIMGNGSIKGHRLQETCLASSIKETPVWESVEPLKMRIAHLEEELARRDRELRA
QENQLQSLQRELEAKVSQIDKLQDAIGYNSLGRSPPAPLRHSRRLLSVINQGSMRFHRVA
VEVHRRLKAKEGVSAEPTTRHFCHDHRAHRSSTERQHIRKDSGTKKLINEALMKNDFLKK
LEPQHTREMVDCMYEKIYGAEQLVIQEGEPGNFLYVLAEGLLEVIQNGKFLGQMRPGTAF
GELAILYNCKRTATVKAVSQSHIWALDRQTFQTIMMRSTQARHEEYFSFLRSVSLLKDLP
EEKLAKIIDCLEIDYFDKGEYIIREGEEGNTFFIIAKGEVSVTQTTEGFTEPQEIKTLRV
GDYFGEKALISEDVRSANIIAKENDTQCLVVDRDNFNEMVGTYEELQAYLREYVEELSLS
DERRNAVPQSPLYERSPEAAELRRLKEKATALSSTSFLKELQVVATLGMGGFGRVELVKL
KDSEDTAFALKCIKKKHIVDTRQQEHIYSEKIILQQTNSNFIVRLFRTFRDDKFVYMLLE
VCLGGELWSLLRDMSCFDEPTARFCTGCVLEAFDYLHGKGIVYRDLKPENLLLDAEGYVK
MADFGFAKKIGLGKKTWTFCGTPEYVAPEVIMNKGHDFGADCWSLGILIFELLIGSPPFT
GSDPIRIYTMVLHGIEKVDIPKRISKRPEDLIRRLCKLNPAERLGNKKNGIIDIKKHKWF
QGFNWEGLRRRKLMSPLRRELKGPLDHSYFDMFPPELEEPPDEFSGWDKDF
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggttccaagtcactctcttatcatggggaacggttcgatcaaaggccatcggctacag
gagacatgtctggcctccagcataaaagagaccccagtatgggagtctgtggagcccctg
aagatgcggattgcccatcttgaggaggagctggcacggagggaccgggagctccgtgca
caggagaatcagttacagagccttcaaagggaactagaggcaaaggtgtcccagattgat
aagctccaagatgccatcgggtataacagcctcggccgctctccaccagcaccactgaga
cacagccgcagactactgagcgtgatcaaccagggatccatgcgcttccacagagttgct
gtggaggtgcatcgacggctaaaagccaaagagggtgtttcagctgaacccacgaccagg
cacttctgtcatgaccacagggcccatcgtagctccactgagagacaacacatccgcaaa
gactcaggcactaagaaactgataaatgaagccctcatgaagaatgacttcctgaagaag
ctggaacctcagcacactagagagatggtggactgtatgtatgagaaaatctatggggct
gagcagctggttatccaggagggagagccggggaactttctctatgtgcttgctgagggc
ttattagaggtcattcaaaatggaaagttcctaggtcagatgcgtcctggaacagccttc
ggagagctggccattctctataactgtaaaagaactgctacggtcaaagctgtgtctcag
tcccatatctgggctctggaccggcagacgttccagactatcatgatgagatccactcag
gccagacacgaggagtacttcagcttcctgcgcagcgtgtcattgttgaaagatctgcca
gaagagaaacttgccaaaatcattgactgtcttgaaattgattactttgacaaaggagag
tacattattcgtgaaggcgaggaaggaaacactttctttatcatagctaaaggagaggtg
tcagtaacacagactacagaggggtttacagaaccacaggagattaagactcttagagtg
ggtgattactttggggaaaaggctctcataagtgaggatgtccgctcggctaatatcatt
gcaaaggaaaatgacacgcagtgcttggtggtggatagagataacttcaatgagatggtt
ggaacctatgaggagctgcaagcgtatctgagggagtatgtggaggagctctctctgagt
gatgagaggaggaatgcagtgcctcagtcgcccctttatgaacgctctccagaggcagca
gagctcaggaggctgaaagagaaggcaactgctttgtccagtacctcctttctgaaggaa
ctgcaagttgtggccactttaggcatgggaggctttggacgcgtagagctggtcaagctt
aaagattcagaagacacagcatttgccttaaagtgcattaagaaaaagcacattgtggac
accaggcagcaagagcacatctattcagaaaagatcattcttcaacagaccaattcaaac
tttattgtaaggttgttccggacatttcgagatgataagtttgtttacatgctgcttgag
gtttgcctgggaggagaactctggagcttattaagggacatgagttgctttgatgagccc
acggcccgcttctgcactggatgtgtgctggaggcttttgattatcttcatggcaaaggc
atcgtctaccgagacctgaagccagagaatcttcttctggatgccgaaggctatgtcaaa
atggctgattttggctttgccaaaaagattggactaggtaagaagacttggacattctgt
ggcactcccgagtatgtggctcctgaggtcatcatgaataagggtcatgactttggagca
gactgttggtccttgggcattctcatctttgaactcttgattggaagccctccattcaca
gggtctgatccaatcaggatttataccatggttcttcatggaatagagaaagtagacatt
cctaagaggatcagcaagcgtccagaagatctcatacggagactttgcaaactcaatcca
gcagaacggcttgggaataaaaagaatggcatcatagatataaagaaacacaaatggttt
caaggtttcaactgggaaggattgagacgccggaagctgatgtctcctctaaggagagag
ctcaagggacctctggatcacagctattttgacatgtttccccctgagctcgaagagcct
ccagatgaattctctggctgggataaagacttctga

DBGET integrated database retrieval system