KEGG   Danio rerio (zebrafish): 556522Help
Entry
556522            CDS       T01004                                 

Gene name
agmat
Definition
(RefSeq) agmatinase, mitochondrial
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00330  Arginine and proline metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    556522 (agmat)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     556522 (agmat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 556522
NCBI-ProteinID: NP_001071019
ZFIN: ZDB-GENE-060929-696
Ensembl: ENSDARG00000059700
UniProt: Q08C97
Position
23
AA seq 366 aa AA seqDB search
MFSSIRIANKSRALFAGSQGLKACASQRLGKCGKLDGDQSSVNVSFRRPISGKSFNVPPS
AEFVARVSGIATMCKLPFQETADGLDAAFVGVPIDTGTSNRPGARFGPRHIRAESAMIRA
YCGWTRAAPYESIKVADIGDINVNLFDLKDTCKKIQEAYRKIVATGCIPLTLGGDHTIAY
PILQAVAERHGPVGLIHVDAHADTSDMILGEKIGHGTPFRRCVDEGLLDCKRVAQIGLRG
SGYSPDNYEWSRGQGFRVVEAVECWHKSLVPLMEEVRSQMGSGPVYLSFDIDSLDPAFAP
GTGTPEIAGLTPIQGLEIIRGCRGLNLVGCDLVEVSPPYDTTGNTALLGANLLFEMMCVL
PKVKYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctcgatcagaatcgctaataaaagtcgtgcgctgtttgctggatctcagggt
ttgaaagcatgcgcttcgcagagactggggaaatgtggaaagcttgacggagatcagagc
agtgtaaatgtgtctttcagacggccgatatccggtaaaagctttaatgttccaccgagc
gcggagtttgtggctcgggtcagcggaatcgcgactatgtgcaaactgccatttcaggaa
accgcggacggactggacgcggcgtttgtcggggttcctattgacaccggaacgtccaac
cggcccggtgcacggtttggaccgagacacatcagggcagaatctgctatgatcagggca
tactgtggctggacgagagcagctccatatgaatcaatcaaagtggcagatatcggtgac
attaacgtcaacctctttgacctgaaggacacctgcaaaaaaatacaggaggcttaccgt
aaaatcgtggccaccggctgcatcccactaaccctgggaggagatcataccattgcatac
ccgatccttcaagctgttgctgagagacatggtccggtaggcctgattcatgtggatgcc
catgcggacactagtgacatgattctgggggagaagattggtcacgggacgcctttcaga
cgctgcgtggatgagggtcttctggactgcaaaagggttgcccagatcgggctcagagga
tccggttattctccagataattatgagtggagccgaggacagggtttccgtgtggtggaa
gctgtggagtgttggcacaaatctctggtcccgctgatggaggaggttcgctctcagatg
ggaagcggtccagtctatctgagctttgacattgacagtctggaccctgcgtttgctccg
ggcacaggaacacctgagattgctggtctcacacccattcagggtctggaaatcatccga
ggctgtcgaggtcttaatcttgtgggctgcgatttagttgaagtttctccaccttacgac
accacaggaaacactgctttgctcggtgccaacctcctctttgagatgatgtgcgtcctt
cccaaagtcaaatactattga

DBGET integrated database retrieval system