KEGG   Danio rerio (zebrafish): 556522Help
Entry
556522            CDS       T01004                                 

Gene name
agmat, auh, zgc:153353
Definition
agmatine ureohydrolase (agmatinase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dre00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
23
AA seq 366 aa AA seqDB search
MFSSIRIANKSRALFAGSQGLKACASQRLGKCGKLDGDQSSVNVSFRRPISGKSFNVPPS
AEFVARVSGIATMCKLPFQETADGLDAAFVGVPIDTGTSNRPGARFGPRHIRAESAMIRA
YCGWTRAAPYESIKVADIGDINVNLFDLKDTCKKIQEAYRKIVATGCIPLTLGGDHTIAY
PILQAVAERHGPVGLIHVDAHADTSDMILGEKIGHGTPFRRCVDEGLLDCKRVAQIGLRG
SGYSPDNYEWSRGQGFRVVEAVECWHKSLVPLMEEVRSQMGSGPVYLSFDIDSLDPAFAP
GTGTPEIAGLTPIQGLEIIRGCRGLNLVGCDLVEVSPPYDTTGNTALLGANLLFEMMCVL
PKVKYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctcgatcagaatcgctaataaaagtcgtgcgctgtttgctggatctcagggt
ttgaaagcatgcgcttcgcagagactggggaaatgtggaaagcttgacggagatcagagc
agtgtaaatgtgtctttcagacggccgatatccggtaaaagctttaatgttccaccgagc
gcggagtttgtggctcgggtcagcggaatcgcgactatgtgcaaactgccatttcaggaa
accgcggacggactggacgcggcgtttgtcggggttcctattgacaccggaacgtccaac
cggcccggtgcacggtttggaccgagacacatcagggcagaatctgctatgatcagggca
tactgtggctggacgagagcagctccatatgaatcaatcaaagtggcagatatcggtgac
attaacgtcaacctctttgacctgaaggacacctgcaaaaaaatacaggaggcttaccgt
aaaatcgtggccaccggctgcatcccactaaccctgggaggagatcataccattgcatac
ccgatccttcaagctgttgctgagagacatggtccggtaggcctgattcatgtggatgcc
catgcggacactagtgacatgattctgggggagaagattggtcacgggacgcctttcaga
cgctgcgtggatgagggtcttctggactgcaaaagggttgcccagatcgggctcagagga
tccggttattctccagataattatgagtggagccgaggacagggtttccgtgtggtggaa
gctgtggagtgttggcacaaatctctggtcccgctgatggaggaggttcgctctcagatg
ggaagcggtccagtctatctgagctttgacattgacagtctggaccctgcgtttgctccg
ggcacaggaacacctgagattgctggtctcacacccattcagggtctggaaatcatccga
ggctgtcgaggtcttaatcttgtgggctgcgatttagttgaagtttctccaccttacgac
accacaggaaacactgctttgctcggtgccaacctcctctttgagatgatgtgcgtcctt
cccaaagtcaaatactattga

DBGET integrated database retrieval system