KEGG   Danio rerio (zebrafish): 556522Help
Entry
556522            CDS       T01004                                 

Gene name
agmat, auh, zgc:153353
Definition
agmatine ureohydrolase (agmatinase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dre  Danio rerio (zebrafish)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    556522 (agmat)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     556522 (agmat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ZFIN: 
Ensembl: 
UniProt: 
Position
23
AA seq 366 aa AA seqDB search
MFSSIRIANKSRALFAGSQGLKACASQRLGKCGKLDGDQSSVNVSFRRPISGKSFNVPPS
AEFVARVSGIATMCKLPFQETADGLDAAFVGVPIDTGTSNRPGARFGPRHIRAESAMIRA
YCGWTRAAPYESIKVADIGDINVNLFDLKDTCKKIQEAYRKIVATGCIPLTLGGDHTIAY
PILQAVAERHGPVGLIHVDAHADTSDMILGEKIGHGTPFRRCVDEGLLDCKRVAQIGLRG
SGYSPDNYEWSRGQGFRVVEAVECWHKSLVPLMEEVRSQMGSGPVYLSFDIDSLDPAFAP
GTGTPEIAGLTPIQGLEIIRGCRGLNLVGCDLVEVSPPYDTTGNTALLGANLLFEMMCVL
PKVKYY
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttttcctcgatcagaatcgctaataaaagtcgtgcgctgtttgctggatctcagggt
ttgaaagcatgcgcttcgcagagactggggaaatgtggaaagcttgacggagatcagagc
agtgtaaatgtgtctttcagacggccgatatccggtaaaagctttaatgttccaccgagc
gcggagtttgtggctcgggtcagcggaatcgcgactatgtgcaaactgccatttcaggaa
accgcggacggactggacgcggcgtttgtcggggttcctattgacaccggaacgtccaac
cggcccggtgcacggtttggaccgagacacatcagggcagaatctgctatgatcagggca
tactgtggctggacgagagcagctccatatgaatcaatcaaagtggcagatatcggtgac
attaacgtcaacctctttgacctgaaggacacctgcaaaaaaatacaggaggcttaccgt
aaaatcgtggccaccggctgcatcccactaaccctgggaggagatcataccattgcatac
ccgatccttcaagctgttgctgagagacatggtccggtaggcctgattcatgtggatgcc
catgcggacactagtgacatgattctgggggagaagattggtcacgggacgcctttcaga
cgctgcgtggatgagggtcttctggactgcaaaagggttgcccagatcgggctcagagga
tccggttattctccagataattatgagtggagccgaggacagggtttccgtgtggtggaa
gctgtggagtgttggcacaaatctctggtcccgctgatggaggaggttcgctctcagatg
ggaagcggtccagtctatctgagctttgacattgacagtctggaccctgcgtttgctccg
ggcacaggaacacctgagattgctggtctcacacccattcagggtctggaaatcatccga
ggctgtcgaggtcttaatcttgtgggctgcgatttagttgaagtttctccaccttacgac
accacaggaaacactgctttgctcggtgccaacctcctctttgagatgatgtgcgtcctt
cccaaagtcaaatactattga

DBGET integrated database retrieval system